Sequence of ECE1_CAVPO

EC Number
Recommended Name
Accession Code
Organism
No of amino acids
Molecular Weight [Da]
Source
endothelin-converting enzyme 1
P97739
Cavia porcellus
754
85772
Reaction
Hydrolysis of the -Trp21-/-Val- bond in big endothelin to form endothelin 1
Sequences with same EC No.
Sequence
show sequence in normal format
>P97739|endothelin-converting enzyme 1|EC 3.4.24.71|Cavia porcellus|Swiss-Prot
MMSTYKRATLDEEDLVDSLSEGEVYPNGLQVNFRNFRSSQRCWATRTQVEKRLIVLVALL
AAGLVACLTALGIQYRTRTPPVCLSEACVSVTSSILNSMNPTVDPCQDFFSYACGGWIKA
NPVPDGHSRWGAFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRA
KPLMELIEKLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNRNVIHVD
QSGLGLPSRDYYLNKTENEKVLNGYLNYMVQLGKLLGGGDENAIRAQMQQILDFETALAN
ITIPQEKRRDEELIYHKVTAAELQTLAPAINWLPFLNTIFYPVEINESEPIVVYDKEYLE
QVSTLINTTDKCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEVMYGTKKTCLPRWKFCV
SDTENNLGFGLGPMFVKATFAEDSKNIASEIILEIKKAFEESLSTLKWMDEDTRKSAKEK
ADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTAEQLRKAPNRD
QWSMTPPMVNAYYSPTKNEIVFPAGILPAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQ
GREYDKDGNLRPWWKNSSVEAFKQQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLK
AAYRAYQNWVKKNGAEETLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSR
FRVIGSLSNSKEFSEHFQCPPGSPMNPRHKCEVW
Download this sequence
in fasta format
Download all sequences for 3.4.24.71
in fasta format
in csv (Excel, OpenOffice) format
Sequence related references
Sequence Reference
Authors
Title
Journal
Volume
Pages
Year
PubMed ID
523197
Shima H.,Yamanouchi M.,Omori K.,Sugiura M.,Kawashima K.,Sato T.
Endothelin-1 production and endothelin converting enzyme expression by guinea pig airway epithelial cells.
Biochem. Mol. Biol. Int.
37
1001-1010
1995