Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 52 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21Abz-LSFMAIQ-EDDnp + H2O - Rhizomucor miehei Abz-LSF + MAIQ-EDDnp - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21Ac-Ala-Ala-(4-nitro)Phe-Ala-Ala + H2O - Rhizopus sp. ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21Ac-Ala-Ala-Lys-(4-nitro)Phe-Ala-Ala + H2O - Rhizopus sp. Ac-Ala-Ala-Lys + (4-nitro)Phe-Ala-Ala - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21casein + H2O - Rhizopus arrhizus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21casein + H2O - Rhizopus niveus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21casein + H2O - Rhizomucor miehei ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O i.e. insulin B chain, cleavage site specificity Rhizopus arrhizus L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O i.e. insulin B chain, cleavage site specificity Rhizopus microsporus var. chinensis L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21KAIEF p-nitrophenylalanine-RL + H2O - Rhizopus sp. KAIEF + p-nitrophenylalanine-RL - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.21KLIEF p-nitrophenylalanine-RL + H2O - Rhizopus sp. KLIEF + p-nitrophenylalanine-RL - ?
Results 1 - 10 of 52 > >>