Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 21 > >>
EC Number Substrates Commentary Substrates Organism Products Commentary (Products) Reversibility
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29Ala-Phe-Gly-Ala + H2O - Irpex lacteus Ala-Phe + Gly-Ala - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29Ala-Phe-Leu-Ala + H2O - Irpex lacteus Ala-Phe + Leu-Ala - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29alpha1-casein + H2O cleavage of Phe23-Phe24 and Lys103-Tyr104 bonds at pH 6.0 Irpex lacteus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29angiotensin I + H2O hydrolyzes Tyr4-Ile5 bond much more rapidly than the Val3-Tyr4 bond Irpex lacteus Asp-Arg-Val-Tyr-Ile-His-Pro + Phe-His-Leu - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29beta-casein + H2O cleavage of Leu165-Ser166, Ala189-Phe190, and Leu192-Tyr193 bonds, no cleavage of Leu139-Leu140 and Ser142-Trp143 bonds Irpex lacteus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29casein + H2O - Irpex lacteus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O i.e. insulin B chain, cleavage site specificity at pH 3.0.the Ala14-Leu15 bond is preferred Irpex lacteus FVNQHLCGSHL + VEA + LYLVCGERGF + FYT + PKA - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29Gly-Phe-Leu-Ala + H2O - Irpex lacteus Gly-Phe + Leu-Ala - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29Hemoglobin + H2O - Irpex lacteus ? - ?
Display the word mapDisplay the reaction diagram Show all sequences 3.4.23.29Hemoglobin + H2O - Irpex lacteus Proteolytically cleaved hemogobin - ?
Results 1 - 10 of 21 > >>