Refine search

Search Substrates and Products (Substrate)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search

Search term:

Results 1 - 10 of 20 > >>
EC Number
Substrates
Commentary Substrates
Organism
Products
Commentary (Products)
Reversibility
Ala-Phe-Gly-Ala + H2O
-
Ala-Phe + Gly-Ala
-
-
Ala-Phe-Leu-Ala + H2O
-
Ala-Phe + Leu-Ala
-
-
alpha1-casein + H2O
cleavage of Phe23-Phe24 and Lys103-Tyr104 bonds at pH 6.0
?
-
?
Angiotensin I + H2O
hydrolyzes Tyr4-Ile5 bond much more rapidly than the Val3-Tyr4 bond
Proteolytically cleaved angiotensin
-
-
beta-casein + H2O
cleavage of Leu165-Ser166, Ala189-Phe190, and Leu192-Tyr193 bonds, no cleavage of Leu139-Leu140 and Ser142-Trp143 bonds
?
-
?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
i.e. insulin B chain, cleavage site specificity at pH 3.0.the Ala14-Leu15 bond is preferred
FVNQHLCGSHL + VEA + LYLVCGERGF + FYT + PKA
-
?
Gly-Phe-Leu-Ala + H2O
-
Gly-Phe + Leu-Ala
-
-
Hemoglobin + H2O
-
?
-
?
Hemoglobin + H2O
-
Proteolytically cleaved hemogobin
-
-
kappa-casein + H2O
cleavage of Phe105-Met106 bond
?
-
?
Results 1 - 10 of 20 > >>