Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Activating Compound

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Image of 2D Structure
Search for synonyms (with exact matching search term)

Search term:

Results 1 - 8 of 8
EC Number Activating Compound Commentary Reference
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11androgen androgens positively regulate neural expression of neprilysin in adult male rats 699666
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11dihydrotestosterone induces a time-dependent increase in neprilysin expression. Dihydrotestosterone also significantly decreases levels of amyloid beta in androgen receptor-expressing cells transfected with amyloid precursor protein, but does not affect levels of either full-length or non-amyloidogenic, soluble amyloid precursor protein. The dihydrotestosterone-induced decrease of amyloid beta is blocked by pharmacological inhibition of neprilysin. The dihydrotestosterone-mediated increase in neprilysin expression and decrease in amyloid beta levels are not observed in rat pheochromocytoma cell 12 lacking androgen receptor and blocked in androgen receptor-expressing cells by the antagonists, cyproterone acetate and flutamide 699666
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11estrogen estrogen stimulates degradation of beta-amyloid peptide by up-regulating neprilysin 709162
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11K49-P1-20 a 20 amino acid peptide from the venom of Bothrops asper, the N-terminal domain of Bothrops asper myotoxin II enhances the activity of neprilysin to 1605% of control. The presence of K49-P1-20 increases the Vmax of NEP by 5.2fold, K49-P1-20 also increases Km of NEP by 3.3fold. N-terminal biotinylation of K49-P1-20 has no significant effect on its ability to stimulate the enzyme, there is only a minimal interaction between the enzyme and the biotinylated version of inverted K49-P1-20. Slight activation of recombinant NEP expressed in HEK-293 cells in vivo 755423
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11K49-P1-34 the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II 755423
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11minocycline minocycline abrogates the amyloid beta(25-35)-induced decrease of somatostatin-like immunoreactive content, somatostatin mRNA levels, phosphorylated-cAMP-response element binding protein CREB content and neprilysin levels. Minocycline alone enhances these targets 699940
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11more both staurosporine-stimulated caspase-3 activation, p53 and neprilysin expression and activity are not affected by over-expression or depletion of presenilin complex component TMP21 695993
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.11SLFELGKMILQETGKNPAKSYGAYGNCCGVLGRG the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II 755423
Results 1 - 8 of 8