3.4.24.11	androgen	androgens positively regulate neural expression of neprilysin in adult male rats	699666	
3.4.24.11	dihydrotestosterone	induces a time-dependent increase in neprilysin expression. Dihydrotestosterone also significantly decreases levels of amyloid beta in androgen receptor-expressing cells transfected with amyloid precursor protein, but does not affect levels of either full-length or non-amyloidogenic, soluble amyloid precursor protein. The dihydrotestosterone-induced decrease of amyloid beta is blocked by pharmacological inhibition of neprilysin. The dihydrotestosterone-mediated increase in neprilysin expression and decrease in amyloid beta levels are not observed in rat pheochromocytoma cell 12 lacking androgen receptor and blocked in androgen receptor-expressing cells by the antagonists, cyproterone acetate and flutamide	699666	
3.4.24.11	estrogen	estrogen stimulates degradation of beta-amyloid peptide by up-regulating neprilysin	709162	
3.4.24.11	K49-P1-20	a 20 amino acid peptide from the venom of Bothrops asper, the N-terminal domain of Bothrops asper myotoxin II enhances the activity of neprilysin to 1605% of control. The presence of K49-P1-20 increases the Vmax of NEP by 5.2fold, K49-P1-20 also increases Km of NEP by 3.3fold. N-terminal biotinylation of K49-P1-20 has no significant effect on its ability to stimulate the enzyme, there is only a minimal interaction between the enzyme and the biotinylated version of inverted K49-P1-20. Slight activation of recombinant NEP expressed in HEK-293 cells in vivo	755423	
3.4.24.11	K49-P1-34	the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II	755423	
3.4.24.11	minocycline	minocycline abrogates the amyloid beta(25-35)-induced decrease of somatostatin-like immunoreactive content, somatostatin mRNA levels, phosphorylated-cAMP-response element binding protein CREB content and neprilysin levels. Minocycline alone enhances these targets	699940	
3.4.24.11	additional information	both staurosporine-stimulated caspase-3 activation, p53 and neprilysin expression and activity are not affected by over-expression or depletion of presenilin complex component TMP21	695993	
3.4.24.11	SLFELGKMILQETGKNPAKSYGAYGNCCGVLGRG	the synthetic peptide corresponding to the N-terminal region mimicks the stimulator effects of Bothrops asper myotoxin II	755423