EC Number | Localization | Comment | Organism | GeneOntology No. | Textmining |
---|---|---|---|---|---|
2.4.99.18 | membrane | associated | Homo sapiens | 16020 | - |
EC Number | Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
---|---|---|---|---|---|---|---|
2.4.99.18 | dolichyl diphosphooligosaccharide + [protein]-L-asparagine | Homo sapiens | - |
dolichyl diphosphate + [protein]-L-asparagine-N-oligosaccharide | a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine | ? |
EC Number | Organism | UniProt | Comment | Textmining |
---|---|---|---|---|
2.4.99.18 | Homo sapiens | - |
- |
- |
EC Number | Source Tissue | Comment | Organism | Textmining |
---|---|---|---|---|
2.4.99.18 | commercial preparation | about 95% purity | Homo sapiens | - |
EC Number | Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|---|
2.4.99.18 | dolichyl diphosphooligosaccharide + [protein]-L-asparagine | - |
Homo sapiens | dolichyl diphosphate + [protein]-L-asparagine-N-oligosaccharide | a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine | ? |
EC Number | Subunits | Comment | Organism |
---|---|---|---|
2.4.99.18 | heptamer | the human Ost4 protein contains 37 amino acids, i.e. MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE, Ost4 is a small membrane protein and belongs to one of the seven subunits of human OST, structure analysis by NMR spectroscopy, residues 5-30 adopt an alpha-helical structure, and a kink structure in the transmembrane domain may be important for its function, overview | Homo sapiens |
EC Number | Synonyms | Comment | Organism |
---|---|---|---|
2.4.99.18 | oligosaccharyltransferase | - |
Homo sapiens |
2.4.99.18 | OST | - |
Homo sapiens |