Any feedback?
Please rate this page
(literature.php)
(0/150)

BRENDA support

Literature summary for 3.4.24.29 extracted from

  • Sabat, A.J.; Wladyka, B.; Kosowska-Shick, K.; Grundmann, H.; van Dijl, J.M.; Kowal, J.; Appelbaum, P.C.; Dubin, A.; Hryniewicz, W.
    Polymorphism, genetic exchange and intragenic recombination of the aureolysin gene among Staphylococcus aureus strains (2008), BMC Microbiol., 8, 129.
    View publication on PubMedView publication on EuropePMC
Search for more literature for 3.4.24.29

Organism

Organism UniProt Comment Textmining
Staphylococcus aureus
-
 analysis of polymorphisms in vancomycin-resistant strains, VRS1, HIP11714, strain VRS2, HIP11983 and strain VRS3, HIP13170 reveals a high degree of gene polymorphism. The aur gene is subject to stronger purifying selection than the multilocus sequence typing genes MLST. Proper enzymatic activity and specificity of aureolysin is very important in the processing of other staphylococcal proteins
-

Substrates and Products (Substrate)

Substrates Comment Substrates Organism Products Comment (Products) Rev. Reac.
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O i.e. galanin Staphylococcus aureus Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
-
 ?
Nalpha-furylacryloyl-Gly-Ala-NH2 + H2O very poor substrate Staphylococcus aureus ?
-
 ?
Nalpha-furylacryloyl-Gly-Leu-NH2 Nalpha-furylacryloyl-Gly-Phe-NH2 is a better substrate than Fa-Gly-Leu-NH2 Staphylococcus aureus ?
-
 ?
Nalpha-furylacryloyl-Gly-Phe-NH2 Nalpha-furylacryloyl-Gly-Phe-NH2 is a better substrate than Fa-Gly-Leu-NH2 Staphylococcus aureus ?
-
 ?
Nalpha-furylacryloyl-Gly-Val-NH2 + H2O very poor substrate Staphylococcus aureus ?
-
 ?