Any feedback?
Literature summary for 3.4.23.42 extracted from
- Thermopsin (2004), Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. ), 1, 225-227.
No PubMed abstract available
Cloned(Commentary)
| Cloned (Comment) | Organism |
|---|---|
| expression in Escherichia coli inclusion bodies, expression in insect cells | Sulfolobus acidocaldarius |
Inhibitors
| Inhibitors | Comment | Organism | Structure |
|---|---|---|---|
| 1,2-epoxy-3-(4-nitrophenoxy)propane | inactivation | Sulfolobus acidocaldarius |  |
| acetamide | - |
Sulfolobus acidocaldarius | |
| Diazoacetyl-DL-norleucine methyl ester | i.e. DAN, inactivation | Sulfolobus acidocaldarius | |
| Mercuric acetate | - |
Sulfolobus acidocaldarius | |
| additional information | no inhibition by iodoacetate and 4-chloromercuribenzoate | Sulfolobus acidocaldarius | |
| pepstatin A | competitive inhibition | Sulfolobus acidocaldarius | |
| phenylalaninamide | - |
Sulfolobus acidocaldarius | |
| Urea | - |
Sulfolobus acidocaldarius | |
Localization
| Localization | Comment | Organism | GeneOntology No. | Textmining |
|---|---|---|---|---|
| extracellular | attached to the cell suface | Sulfolobus acidocaldarius | - |
- |
Molecular Weight [Da]
| Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
|---|---|---|---|
| 32651 | - |
x * 32651, amino acid sequence calculation, x * 46000-51000, glycosylated enzyme | Sulfolobus acidocaldarius |
Natural Substrates/ Products (Substrates)
| Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| Hemoglobin + H2O | Sulfolobus acidocaldarius | - |
? | - |
? | |
| additional information | Sulfolobus acidocaldarius | the enzyme shows a broad protein substrate specificity, it is involved in supply of nutrients from protein substrates | ? | - |
? | |
Organism
| Organism | UniProt | Comment | Textmining |
|---|---|---|---|
| Sulfolobus acidocaldarius | - |
originally isolated from hot springs of the Yellowstone Park | - |
Posttranslational Modification
| Posttranslational Modification | Comment | Organism |
|---|---|---|
| glycoprotein | the enzyme has 11 potential glycosylation sites, e.g. at Asn24 and Asn28 | Sulfolobus acidocaldarius |
Purification (Commentary)
| Purification (Comment) | Organism |
|---|---|
| native enzyme from cell culture by solubilization with detergents, ultrafiltration and five chromatographic steps to homogeneity | Sulfolobus acidocaldarius |
Renatured (Commentary)
| Renatured (Comment) | Organism |
|---|---|
| recombinant enzyme from Escherichia coli inclusion bodies by treatment with 8 M urea, incubation in acid solution, and gel filtration | Sulfolobus acidocaldarius |
Source Tissue
| Source Tissue | Comment | Organism | Textmining |
|---|---|---|---|
| additional information | optimal cell cultivation at pH 2.0 and 70°C | Sulfolobus acidocaldarius | - |
Substrates and Products (Substrate)
| Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | substrate insulin B chain | Sulfolobus acidocaldarius | FVNQHLCGSHL + VEAL + YLVCGERGF + L-Phe + YTPKA | - |
? | |
| Hemoglobin + H2O | - |
Sulfolobus acidocaldarius | ? | - |
? | |
| Lys-Pro-Ala-Glu-Phe-Nph-Ala-Leu + H2O | synthetic chromogenic substrate | Sulfolobus acidocaldarius | Lys-Pro-Ala-Glu-Phe + Nph-Ala-Leu | - |
? | |
| additional information | the enzyme shows a broad protein substrate specificity, it is involved in supply of nutrients from protein substrates | Sulfolobus acidocaldarius | ? | - |
? | |
| additional information | the enzyme shows a broad protein substrate specificity | Sulfolobus acidocaldarius | ? | - |
? | |
Subunits
| Subunits | Comment | Organism |
|---|---|---|
| ? | x * 32651, amino acid sequence calculation, x * 46000-51000, glycosylated enzyme | Sulfolobus acidocaldarius |
Synonyms
| Synonyms | Comment | Organism |
|---|---|---|
| More | the enzyme belongs to the A5 peptidase family | Sulfolobus acidocaldarius |
Temperature Optimum [°C]
| Temperature Optimum [°C] | Temperature Optimum Maximum [°C] | Comment | Organism |
|---|---|---|---|
| 40 | 80 | substrate hemoglobin | Sulfolobus acidocaldarius |
Temperature Range [°C]
| Temperature Minimum [°C] | Temperature Maximum [°C] | Comment | Organism |
|---|---|---|---|
- |
100 | activity range, substrate hemoglobin, slow activity increase between 26°C and 65°C, rapid increase above 65°C | Sulfolobus acidocaldarius |
pH Optimum
| pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
|---|---|---|---|
| 2 | - |
- |
Sulfolobus acidocaldarius |
pH Range
| pH Minimum | pH Maximum | Comment | Organism |
|---|---|---|---|
- |
12 | activity range, highest activity at pH 1.0- pH 5.0, substrate hemoglobin | Sulfolobus acidocaldarius |
Ki Value [mM]
| Ki Value [mM] | Ki Value maximum [mM] | Inhibitor | Comment | Organism | Structure |
|---|---|---|---|---|---|
| 0.00012 | - |
pepstatin A | 56°C | Sulfolobus acidocaldarius | |
| 0.0002 | - |
pepstatin A | 76°C | Sulfolobus acidocaldarius | |
| 0.00049 | - |
pepstatin A | 37°C | Sulfolobus acidocaldarius | |
| 10 | - |
phenylalaninamide | - |
Sulfolobus acidocaldarius | |
| 400 | - |
acetamide | - |
Sulfolobus acidocaldarius | |
| 500 | - |
Urea | - |
Sulfolobus acidocaldarius | |
Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.
Release 2023.1 (January 2023)
Legal
Curated at
Member of
