BRENDA - Enzyme Database show
show all sequences of 3.4.23.31

Scytalidopepsin A

Murao, S.; Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. ) 1, 224-225 (2004)
No PubMed abstract available

Data extracted from this reference:

Inhibitors
Inhibitors
Commentary
Organism
Structure
additional information
the enzyme is insensitive to pepstatin and inhibitor S-PI, i.e. Ac-VV-statine-A-statine, statine is 4-amino-3-hydroxy-6-methylheptanoic acid, no inhibition by diazoacetyl-DL-norleucine methyl ester or 1,2-epoxy-3-(4-nitrophenoxy)propane
Scytalidium lignicola
Localization
Localization
Commentary
Organism
GeneOntology No.
Textmining
extracellular
the enzyme is secreted
Scytalidium lignicola
-
-
Molecular Weight [Da]
Molecular Weight [Da]
Molecular Weight Maximum [Da]
Commentary
Organism
40000
-
sedimentation equilibrium analysis
Scytalidium lignicola
Natural Substrates/ Products (Substrates)
Natural Substrates
Organism
Commentary (Nat. Sub.)
Natural Products
Commentary (Nat. Pro.)
Organism (Nat. Pro.)
Reversibility
additional information
Scytalidium lignicola
the enzyme is involved in protein degradation in wood destroying by the fungus
?
-
-
-
Organism
Organism
Primary Accession No. (UniProt)
Commentary
Textmining
Scytalidium lignicola
-
strain ATCC 24568, isozymes A-1 and A-2
-
Posttranslational Modification
Posttranslational Modification
Commentary
Organism
glycoprotein
the enzyme contains 3 mol of glucosamine and 10 mol of mannose
Scytalidium lignicola
Specific Activity [micromol/min/mg]
Specific Activity Minimum [Ámol/min/mg]
Specific Activity Maximum [Ámol/min/mg]
Commentary
Organism
additional information
-
-
Scytalidium lignicola
Substrates and Products (Substrate)
Substrates
Commentary Substrates
Literature (Substrates)
Organism
Products
Commentary (Products)
Literature (Products)
Organism (Products)
Reversibility
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
i.e. insulin B chain, cleavage site specificity
668806
Scytalidium lignicola
FVNQHLC + GSHLVEALYLVCGERGF + FYTPKA
-
-
-
?
additional information
the enzyme is involved in protein degradation in wood destroying by the fungus
668806
Scytalidium lignicola
?
-
-
-
-
additional information
no cleavage of the Hi6-Pro7 bond of angiotensin I
668806
Scytalidium lignicola
?
-
-
-
-
Z-Phe-Xaa-Ala-Ala + H2O
cleavage site specificity
668806
Scytalidium lignicola
Z-Phe-Xaa + Ala-Ala
-
-
-
?
Z-Xaa-Leu-Ala-Ala + H2O
cleavage site specificity
668806
Scytalidium lignicola
Z-Xaa-Leu + Ala-Ala
-
-
-
?
pH Optimum
pH Optimum Minimum
pH Optimum Maximum
Commentary
Organism
3
3.5
substrate casein
Scytalidium lignicola
pI Value
Organism
Commentary
pI Value Maximum
pI Value
Scytalidium lignicola
isozyme A-1
-
3.6
Scytalidium lignicola
isozyme A-2
-
3.8
Inhibitors (protein specific)
Inhibitors
Commentary
Organism
Structure
additional information
the enzyme is insensitive to pepstatin and inhibitor S-PI, i.e. Ac-VV-statine-A-statine, statine is 4-amino-3-hydroxy-6-methylheptanoic acid, no inhibition by diazoacetyl-DL-norleucine methyl ester or 1,2-epoxy-3-(4-nitrophenoxy)propane
Scytalidium lignicola
Localization (protein specific)
Localization
Commentary
Organism
GeneOntology No.
Textmining
extracellular
the enzyme is secreted
Scytalidium lignicola
-
-
Molecular Weight [Da] (protein specific)
Molecular Weight [Da]
Molecular Weight Maximum [Da]
Commentary
Organism
40000
-
sedimentation equilibrium analysis
Scytalidium lignicola
Natural Substrates/ Products (Substrates) (protein specific)
Natural Substrates
Organism
Commentary (Nat. Sub.)
Natural Products
Commentary (Nat. Pro.)
Organism (Nat. Pro.)
Reversibility
additional information
Scytalidium lignicola
the enzyme is involved in protein degradation in wood destroying by the fungus
?
-
-
-
Posttranslational Modification (protein specific)
Posttranslational Modification
Commentary
Organism
glycoprotein
the enzyme contains 3 mol of glucosamine and 10 mol of mannose
Scytalidium lignicola
Specific Activity [micromol/min/mg] (protein specific)
Specific Activity Minimum [Ámol/min/mg]
Specific Activity Maximum [Ámol/min/mg]
Commentary
Organism
additional information
-
-
Scytalidium lignicola
Substrates and Products (Substrate) (protein specific)
Substrates
Commentary Substrates
Literature (Substrates)
Organism
Products
Commentary (Products)
Literature (Products)
Organism (Products)
Reversibility
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
i.e. insulin B chain, cleavage site specificity
668806
Scytalidium lignicola
FVNQHLC + GSHLVEALYLVCGERGF + FYTPKA
-
-
-
?
additional information
the enzyme is involved in protein degradation in wood destroying by the fungus
668806
Scytalidium lignicola
?
-
-
-
-
additional information
no cleavage of the Hi6-Pro7 bond of angiotensin I
668806
Scytalidium lignicola
?
-
-
-
-
Z-Phe-Xaa-Ala-Ala + H2O
cleavage site specificity
668806
Scytalidium lignicola
Z-Phe-Xaa + Ala-Ala
-
-
-
?
Z-Xaa-Leu-Ala-Ala + H2O
cleavage site specificity
668806
Scytalidium lignicola
Z-Xaa-Leu + Ala-Ala
-
-
-
?
pH Optimum (protein specific)
pH Optimum Minimum
pH Optimum Maximum
Commentary
Organism
3
3.5
substrate casein
Scytalidium lignicola
pI Value (protein specific)
Organism
Commentary
pI Value Maximum
pI Value
Scytalidium lignicola
isozyme A-1
-
3.6
Scytalidium lignicola
isozyme A-2
-
3.8
Other publictions for EC 3.4.23.31
No.
1st author
Pub Med
title
organims
journal
volume
pages
year
Activating Compound
Application
Cloned(Commentary)
Crystallization (Commentary)
Engineering
General Stability
Inhibitors
KM Value [mM]
Localization
Metals/Ions
Molecular Weight [Da]
Natural Substrates/ Products (Substrates)
Organic Solvent Stability
Organism
Oxidation Stability
Posttranslational Modification
Purification (Commentary)
Reaction
Renatured (Commentary)
Source Tissue
Specific Activity [micromol/min/mg]
Storage Stability
Substrates and Products (Substrate)
Subunits
Temperature Optimum [░C]
Temperature Range [░C]
Temperature Stability [░C]
Turnover Number [1/s]
pH Optimum
pH Range
pH Stability
Cofactor
Ki Value [mM]
pI Value
IC50 Value
Activating Compound (protein specific)
Application (protein specific)
Cloned(Commentary) (protein specific)
Cofactor (protein specific)
Crystallization (Commentary) (protein specific)
Engineering (protein specific)
General Stability (protein specific)
IC50 Value (protein specific)
Inhibitors (protein specific)
Ki Value [mM] (protein specific)
KM Value [mM] (protein specific)
Localization (protein specific)
Metals/Ions (protein specific)
Molecular Weight [Da] (protein specific)
Natural Substrates/ Products (Substrates) (protein specific)
Organic Solvent Stability (protein specific)
Oxidation Stability (protein specific)
Posttranslational Modification (protein specific)
Purification (Commentary) (protein specific)
Renatured (Commentary) (protein specific)
Source Tissue (protein specific)
Specific Activity [micromol/min/mg] (protein specific)
Storage Stability (protein specific)
Substrates and Products (Substrate) (protein specific)
Subunits (protein specific)
Temperature Optimum [░C] (protein specific)
Temperature Range [░C] (protein specific)
Temperature Stability [░C] (protein specific)
Turnover Number [1/s] (protein specific)
pH Optimum (protein specific)
pH Range (protein specific)
pH Stability (protein specific)
pI Value (protein specific)
Expression
General Information
General Information (protein specific)
Expression (protein specific)
KCat/KM [mM/s]
KCat/KM [mM/s] (protein specific)
668806
Murao
-
Scytalidopepsin A ...
Scytalidium lignicola
Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. )
1
224-225
2004
-
-
-
-
-
-
1
-
1
-
1
1
-
1
-
1
-
-
-
-
1
-
5
-
-
-
-
-
1
-
-
-
-
2
-
-
-
-
-
-
-
-
-
1
-
-
1
-
1
1
-
-
1
-
-
-
1
-
5
-
-
-
-
-
1
-
-
2
-
-
-
-
-
-
30559
Majima
-
Comparative study on the speci ...
Scytalidium lignicola
Agric. Biol. Chem.
52
787-793
1988
-
-
-
-
-
-
1
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30756
Oda
-
Purification and characterizat ...
Scytalidium lignicola, Scytalidium lignicola A-2, Scytalidium lignicola C
Agric. Biol. Chem.
50
651-658
1986
-
-
-
-
-
-
2
2
-
-
2
-
-
8
-
1
1
-
-
1
1
-
9
-
1
-
3
-
1
-
2
-
-
-
-
-
-
-
-
-
-
-
-
2
-
2
-
-
2
-
-
-
1
1
-
1
1
-
9
-
1
-
3
-
1
-
2
-
-
-
-
-
-
-
30757
Oda
-
Kinetic studies on S-PI(Pepsta ...
Scytalidium lignicola, Scytalidium lignicola A-2
Agric. Biol. Chem.
50
659-663
1986
-
-
-
-
-
-
-
1
-
-
-
-
-
7
-
-
-
-
-
-
-
-
4
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
4
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30762
Oda
-
Studies on new acid proteases ...
Scytalidium lignicola, Scytalidium lignicola A-2
Agric. Biol. Chem.
50
1995-2001
1986
-
-
-
-
-
-
-
-
-
-
-
-
-
7
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30758
Ichishima
-
Enzymatic cleavage of the hist ...
Scytalidium lignicola
Agric. Biol. Chem.
45
2391-2393
1981
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
2
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30759
Morihara
Pepstatin-insenstive acid prot ...
Scytalidium lignicola, Scytalidium lignicola A-2
J. Biochem.
85
661-668
1979
-
-
-
-
-
-
7
12
-
-
-
-
-
7
-
-
-
-
-
-
-
-
15
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
7
-
12
-
-
-
-
-
-
-
-
-
-
-
-
15
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
30763
Murao
-
Studies on new acid proteases ...
Scytalidium lignicola
Agric. Biol. Chem.
42
1343-1349
1978
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30755
Oda
-
Studies on new acid proteases ...
Scytalidium lignicola
Agric. Biol. Chem.
40
1221-1225
1976
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30760
Oda
-
Pepstatin-insensitive acid pro ...
Scytalidium lignicola, Scytalidium lignicola A-2
Agric. Biol. Chem.
40
859-866
1976
-
-
-
-
-
-
-
-
-
-
1
-
-
7
-
1
-
-
-
-
-
-
27
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1
-
-
-
1
-
-
-
-
-
27
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
30754
Oda
-
New acid proteases from Scytal ...
Scytalidium lignicola, Scytalidium lignicola A-2
Agric. Biol. Chem.
38
2435-2444
1974
-
-
-
-
-
-
4
-
-
2
1
-
-
7
-
1
1
-
-
1
-
-
2
-
1
1
3
-
1
1
2
-
-
-
-
-
-
-
-
-
-
-
-
4
-
-
-
2
1
-
-
-
1
1
-
1
-
-
2
-
1
1
3
-
1
1
2
-
-
-
-
-
-
-