Any feedback?
Literature summary for 3.4.23.12 extracted from
- Nepenthesin (2004), Handbook of Proteolytic Enzymes (Barrett, A. J. , Rawlings, N. D. , Woessner, J. F. , eds. )Academic Press, 1, 85-86.
No PubMed abstract available
Inhibitors
| Inhibitors | Comment | Organism | Structure |
|---|---|---|---|
| Diazoacetyl-DL-norleucine methyl ester | i.e. DAN | Nepenthes distillatoria |  |
| N-(diazoacetyl)-N-(2,4-dinitrophenyl)ethylenediamine | - |
Nepenthes distillatoria | |
| pepstatin | - |
Nepenthes distillatoria | |
Localization
| Localization | Comment | Organism | GeneOntology No. | Textmining |
|---|---|---|---|---|
| extracellular | the enzyme is secreted to the pitcher fluid | Nepenthes distillatoria | - |
- |
Molecular Weight [Da]
| Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
|---|---|---|---|
| 45000 | - |
1 * 45000 | Nepenthes distillatoria |
Organism
| Organism | UniProt | Comment | Textmining |
|---|---|---|---|
| Nepenthes distillatoria | - |
- |
- |
Purification (Commentary)
| Purification (Comment) | Organism |
|---|---|
| by gel filtration, ion exchange chromatography, and pepstatin affinity chromatography, native enzyme to homogeneity | Nepenthes distillatoria |
Source Tissue
| Source Tissue | Comment | Organism | Textmining |
|---|---|---|---|
| pitcher | secretory gland inside the pitcher | Nepenthes distillatoria | - |
| pitcher secretion | - |
Nepenthes distillatoria | - |
Substrates and Products (Substrate)
| Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| casein + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
| Egg albumin + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
| Fibrin + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
| FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | substrate is the insulin B chain | Nepenthes distillatoria | FVNQHL + CGSHLVE + Ala-Leu + Tyr + LVCGERGF + FYTPKA | - |
? | |
| additional information | cleavage site specificity with preference for the carboxy and amino sides of Asp, cleavage of the carboxy side of Ala, Leu, Ser, Thr, and Tyr also occurs, and cleavage on the amino side of Ala, Phe, Thr, Tyr, and Lys | Nepenthes distillatoria | ? | - |
? | |
| Ribonuclease + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
Subunits
| Subunits | Comment | Organism |
|---|---|---|
| monomer | 1 * 45000 | Nepenthes distillatoria |
Synonyms
| Synonyms | Comment | Organism |
|---|---|---|
| More | the enzyme belongs to the A1 peptidase family | Nepenthes distillatoria |
pH Optimum
| pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
|---|---|---|---|
| 2 | 3 | - |
Nepenthes distillatoria |
Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.
Release 2023.1 (January 2023)
Legal
Curated at
Member of
