Ligand L-tyrosine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-tyrosine (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C9H11NO3
L-tyrosine
OUYCCCASQSFEME-QMMMGPOBSA-N
Synonyms:
L-hydroxyphenylalanine, L-Tyr, p-L-Tyr, p-tyrosine, Tyr, tyrosin, tyrosine, Y

Show all pahtways known for Show all pathways known for L-tyrosine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (47 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-tyrosine + O2 = ? + H2O2
show the reaction diagram
-
L-tyrosine + 2 NADP+ + 2 iodide = 3,5-diiodo-L-tyrosine + 2 NADPH + 2 H+
show the reaction diagram
-
S-adenosyl-L-methionine + L-tyrosine = S-adenosyl-L-homocysteine + 3-methyl-L-tyrosine
show the reaction diagram
-
dimethylallyl diphosphate + L-tyrosine = diphosphate + 4-O-dimethylallyl-L-tyrosine
show the reaction diagram
-
L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate
show the reaction diagram
-
4-hydroxybenzoylformate + L-tyrosine = (2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate
show the reaction diagram
-
Tyrosine = ?
show the reaction diagram
-
L-tyrosine + H2O = phenol + pyruvate + NH3
show the reaction diagram
-
ATP + L-tyrosine + tRNAPhe = AMP + diphosphate + L-tyrosinyl-tRNAPhe
show the reaction diagram
-
ATP + L-tyrosine + L-arginine = L-tyrosyl-L-arginine + AMP + diphosphate
show the reaction diagram
-

In Vivo Product in Enzyme-catalyzed Reactions (21 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
3-iodo-L-tyrosine + NADPH + H+ = L-tyrosine + NADP+ + I-
show the reaction diagram
-
-
L-arogenate + NAD+ = L-tyrosine + NADH + CO2
show the reaction diagram
-
L-arogenate + NAD+ = L-tyrosine + NADH + CO2
show the reaction diagram
-
(2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate = 4-hydroxybenzoylformate + L-tyrosine
show the reaction diagram
-
-
L-Tyr benzyl ester + H2O = benzyl alcohol + L-tyrosine
show the reaction diagram
-
-
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
-
-
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
-
-
phosphotyrosine + H2O = tyrosine + phosphate
show the reaction diagram
-
-
Leu-Tyr + H2O = Leu + Tyr
show the reaction diagram
-
alpha-tubulin + H2O = detyrosinated tubulin + Tyr
show the reaction diagram
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 3 H2O = FVNQHLCGSHLVEAL + Tyr + LVCGERGF + FYTPKA
show the reaction diagram
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 6 H2O = FVNQHL + CGSHL + VEAL + L-Tyr + LVCGERGF + L-Phe + YTPKA
show the reaction diagram
-
-

Substrate in Enzyme-catalyzed Reactions (237 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-tyrosine + O2 = ? + H2O2
show the reaction diagram
-
tyrosine + H2O2 + I- = monoiodotyrosine + diiodotyrosine + H2O
show the reaction diagram
-
L-tyrosine + H2O2 + H+ = ?
show the reaction diagram
-
L-tyrosine + O2 = 3-(4-hydroxyphenyl)-2-oxopropanoic acid + NH3
show the reaction diagram
-
L-tyrosine + O2 = 4-hydroxyphenylacetamide + CO2 + H2O
show the reaction diagram
-
L-tyrosine + 2 O2 + 2 [reduced NADPH-hemoprotein reductase] = (E)-[4-hydroxyphenylacetaldehyde oxime] + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
show the reaction diagram
-
tyrosine + 2 O2 + 2 [reduced NADPH-hemoprotein reductase] = (E)-4-hydroxyphenylacetaldoxime + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
show the reaction diagram
-
L-tyrosine + tetrahydropteridine + O2 = ?
show the reaction diagram
-
L-tyrosine + ascorbate + O2 = L-dopa + dehydroascorbate + H2O
show the reaction diagram
-
L-tyrosine + H2O + NAD+ = (4-hydroxyphenyl)pyruvate + NH3 + NADH
show the reaction diagram
-
L-Tyr + O2 + H2O = 3-(4-hydroxyphenyl)-2-oxopropionic acid + NH3 + H2O2
show the reaction diagram
-
L-tyrosine + H2O + 2 cytochrome b = 4-hydroxyphenylpyruvate + NH3 + 2 reduced cytochrome b
show the reaction diagram
-
S-adenosyl-L-methionine + L-tyrosine = S-adenosyl-L-homocysteine + 3-methyl-L-tyrosine
show the reaction diagram
-
dimethylallyl diphosphate + L-tyrosine = diphosphate + 5-[(2E)-pent-2-en-1-yl]-L-tryptophan
show the reaction diagram
-
dimethylallyl diphosphate + L-tyrosine = diphosphate + 3-(3-methylbut-2-enyl)-L-tyrosine
show the reaction diagram
-
2-oxosuccinamic acid + L-tyrosine = L-asparagine + 3-(4-hydroxyphenyl)-2-oxopropanoate
show the reaction diagram
-
L-tyrosine + 2-oxoglutarate = (4-hydroxyphenyl)pyruvate + L-glutamate
show the reaction diagram
-
L-tyrosine + 2-oxoglutarate = 2-oxo-3-phenylpropanoate + L-glutamate
show the reaction diagram
-
phenylpyruvate + L-tyrosine = phenylalanine + 3-(4-hydroxyphenyl)-2-oxopropanoate
show the reaction diagram
-
2-oxoglutarate + L-tyrosine = L-glutamate + 4-hydroxyphenylpyruvate
show the reaction diagram
-
L-tyrosine + 2-oxoglutarate = p-hydroxyphenylpyruvate + L-glutamate
show the reaction diagram
-
L-tyrosine + 2-oxoglutarate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-glutamate
show the reaction diagram
-
L-tyrosine + pyruvate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-alanine
show the reaction diagram
-
tyrosine + glyoxylate = 3-(4-hydroxyphenyl)-2-oxopropanoate + glycine
show the reaction diagram
-
tyrosine + glyoxylate = 3-(4-hydroxyphenyl)-2-oxopropanoate + glycine
show the reaction diagram
-
L-tyrosine + indole-3-pyruvic acid = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-tryptophan
show the reaction diagram
-
3'-phosphoadenylylsulfate + L-tyrosine = adenosine 3',5'-bisphosphate + tyrosine O4-sulfate
show the reaction diagram
-
L-tyrosine + phenylacetamide = N-(phenylacetyl)-L-tyrosine + NH3
show the reaction diagram
-
L-tyrosine + S-adenosyl-L-methionine + reduced acceptor = 2-iminoacetate + 4-methylphenol + 5'-deoxyadenosine + L-methionine + acceptor + 2 H+
show the reaction diagram
-
L-tyrosine = trans-p-hydroxycinnamate + NH3
show the reaction diagram
-
ATP + L-Tyr + H2O = AMP + diphosphate + D-Tyr
show the reaction diagram
-

Product in Enzyme-catalyzed Reactions (240 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
phenylalanine + NAD(P)H + O2 = tyrosine + NAD(P)+ + H2O
show the reaction diagram
-
L-arogenate + NAD+ = L-tyrosine + NADH + CO2
show the reaction diagram
-
-
p-hydroxyphenylpyruvate + NADPH + NH3 = L-tyrosine + NADP+ + H2O
show the reaction diagram
-
-
4-hydroxyphenylpyruvate + NH3 + NADH = L-Tyr + NAD+ + H2O
show the reaction diagram
-
-
5'-phospho-pyridoxyl-L-tyrosine + H2O + O2 = pyridoxal 5'-phosphate + L-tyrosine + H2O2
show the reaction diagram
-
N-methyl-L-tyrosine + O2 + H2O = L-tyrosine + formaldehyde + H2O2
show the reaction diagram
-
-
5-L-glutamyl-L-Tyr + Gly-Gly = L-Tyr + 5-L-glutamyl-Gly-Gly
show the reaction diagram
-
-
L-aspartate + 4-hydroxyphenylpyruvate = oxaloacetate + L-tyrosine
show the reaction diagram
-
-
L-tryptophan + p-hydroxyphenylpyruvate = 3-indole-2-oxopropanoate + tyrosine
show the reaction diagram
-
-
L-leucine + p-hydroxyphenylpyruvate = 2-oxoisohexanoate + L-tyrosine
show the reaction diagram
-
-
L-kynurenine + hydroxyphenylpyruvate = kynurenic acid + L-tyrosine
show the reaction diagram
-
-
4-hydroxyphenylpyruvate + L-aspartate = L-tyrosine + oxaloacetate
show the reaction diagram
-
-
4-hydroxyphenylpyruvate + L-glutamate = L-tyrosine + 2-oxoglutarate
show the reaction diagram
-
-
(2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate = 4-hydroxybenzoylformate + L-tyrosine
show the reaction diagram
-
-
L-Tyr ethyl ester + H2O = L-Tyr + ethanol
show the reaction diagram
-
-
Tyr-tRNA + H2O = Tyr + tRNA
show the reaction diagram
-
-
L-Tyr benzyl ester + H2O = benzyl alcohol + L-tyrosine
show the reaction diagram
-
-
methyl L-tyrosine + H2O = methanol + L-tyrosine
show the reaction diagram
-
-
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
-
-
O-phospho-L-tyrosine + H2O = L-Tyr + phosphate
show the reaction diagram
-
O-phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
-
-
Tyr-O-sulfate + H2O = Tyr + sulfate
show the reaction diagram
-
-
tyrosine O-sulfate + H2O = tyrosine + sulfate
show the reaction diagram
-
-
L-tyrosine-7-amido-4-methylcoumarin + H2O = L-tyrosine + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
Tyr-Gly-Gly-Phe-Leu + H2O = Tyr + Gly-Gly-Phe-Leu
show the reaction diagram
-
L-Tyr-2-naphthylamide + H2O = L-Tyr + 2-naphthylamine
show the reaction diagram
-
-
beta-homoVal-beta-homoIle-Tyr + H2O = beta-homoVal + beta-homoIle + Tyr
show the reaction diagram
-
-
neuropeptide Y + H2O = Tyr + ?
show the reaction diagram
-
Gly-Tyr + H2O = Gly + Tyr
show the reaction diagram
-
Ala-Tyr + H2O = Ala + Tyr
show the reaction diagram
-
-
Tyr-Pro + H2O = Tyr + Pro
show the reaction diagram
-
-
Ser-Tyr-NH2 + H2O = Ser + Tyr + NH3
show the reaction diagram
-
-
Tyr-Gly-Gly + H2O = Tyr + Gly-Gly
show the reaction diagram
-
-
L-tyrosyl-L-glutamic acid + H2O = tyrosine + glutamate
show the reaction diagram
-
-
Carbobenzoxy-Phe-Tyr + H2O = Carbobenzoxy-Phe + Tyr
show the reaction diagram
-
-
neurotensin(1-11) + H2O = pELYENKPRRP + Tyr
show the reaction diagram
-
-
Benzyloxycarbonyl-Glu-Tyr + H2O = Benzyloxycarbonyl-Glu + Tyr
show the reaction diagram
-
-
Tyr-Ala + H2O = Tyr + Ala
show the reaction diagram
-
2-aminobenzoyl-Phe-Arg-Tyr + H2O = 2-aminobenzoyl-Phe-Arg + Tyr
show the reaction diagram
-
-
pyroglutamyl-Tyr + H2O = pyroglutamate + Tyr
show the reaction diagram
-
-
L-Tyr ethyl ester + H2O = L-Tyr + ethanol
show the reaction diagram
-
-
Benzyloxycarbonyl-Glu-Tyr + H2O = Benzyloxycarbonyl-Glu + Tyr
show the reaction diagram
-
-
neuropeptide Y3-36 + H2O = neuropeptide Y3-35 + L-tyrosine
show the reaction diagram
-
-
N-benzyloxycarbonyl-Gly-Pro-Tyr + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Tyr
show the reaction diagram
-
-
casein + H2O = L-tyrosine + ?
show the reaction diagram
-
-
Benzyloxycarbonyl-Gly-Tyr + H2O = Benzyloxycarbonyl-Gly + Tyr
show the reaction diagram
-
-
L-tyrosine-p-nitroanilide + H2O = L-tyrosine + 4-nitroaniline
show the reaction diagram
-
MDIGAYPHFMPTNLAGDPY + H2O = AYPHFMPTNLA + AYPHFMPTNLAGD + DIGAYPHFMPTNLAG + IGAYPHFMPTNLAGD + MDIGAYPHFMPTNL + MDIGAYPHFMPTNLA + MDIGAYPHFMPTNLAGD + MDIGAYPHFMPTNLAGDP + Met + MDIG + Met-Asp + Tyr + Pro-Tyr + GDPY + DPY
show the reaction diagram
-
-
MDIGAYPHFMPTNLAGDPY + H2O = YPHFMPTNL + AYPHFMPTNL + YPHFMPTNLA + AYPHFMPTNLAG + AYPHFMPTNLAGD + DIGAYPHFMPTNLA + DIGAYPHFMPTNLAG + YPHFMPTNLAGDPY + IGAYPHFMPTNLAGD + MDIG + MDIGA + Met-Asp + Met + Tyr + Pro-Tyr + GDPY + DPY
show the reaction diagram
-
-
oxidized insulin B chain + H2O = FVNQHLCGSHLVEAL + L-Tyr + LVCGERGFFYTPKA
show the reaction diagram
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHL + CGSHLVE + Ala-Leu + Tyr + LVCGERGF + FYTPKA
show the reaction diagram
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 6 H2O = FVNQHL + CGSHL + VEAL + L-Tyr + LVCGERGF + L-Phe + YTPKA
show the reaction diagram
-
-
Benzyloxycarbonyl-Glu-Tyr + H2O = Benzyloxycarbonyl-Glu + Tyr
show the reaction diagram
-
-
pTLRTKL + H2O = phospho-Thr-Leu-Arg + L-tyrosine + Lys-Leu
show the reaction diagram
-
-
casein + H2O = L-tyrosine + ?
show the reaction diagram
-
-
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O = Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
show the reaction diagram
-
-
insulin chain B fragment 22-30 + H2O = RGFF + Tyr + TPKA
show the reaction diagram
-
L-tyrosine amide + H2O = L-tyrosine + NH3
show the reaction diagram
-
-
N-acetyl-L-tyrosine + H2O = acetate + L-tyrosine
show the reaction diagram
-
-
L-Leu-L-Tyr + H2O = Leu + Tyr
show the reaction diagram
-
-
N-acetyltyrosine + H2O = acetate + tyrosine
show the reaction diagram
-
-
Nalpha-benzyloxycarbonyl-L-Tyr + H2O = benzyl alcohol + CO2 + L-Tyr
show the reaction diagram
-
O-phospo-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
-
-
(2E)-4-hydroxycinnamate + NH3 = L-tyrosine
show the reaction diagram
-
-
5-L-glutamyl-L-tyrosine = 5-oxoproline + L-tyrosine
show the reaction diagram
-

Activator in Enzyme-catalyzed Reactions (23 results)

EC NUMBER
COMMENTARY
LITERATURE
ENZYME 3D STRUCTURE
activates the enzyme
-
stimulates conversion of prostaglandin G1 to H1
-
slightly enhancing the activity
-
slightly enhanced activity
-
5 mM, 1.41fold activation
-
expression increases in response to
-
exposure of 4-week old plants to L-tyrosine at 0.01 or 0.1 mM significantly increases enzyme activity and increases free tyrosine content, while free phenylalanine content decreases. Tyrosine has no effect on coumarin accumulation
-

Inhibitor in Enzyme-catalyzed Reactions (112 results)

EC NUMBER
COMMENTARY
LITERATURE
ENZYME 3D STRUCTURE
80% inhibition at 5 mM
-
slight
-
noncompetitive vs. L-tryptophan and (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin
-
uncompetitive inhibition
-
; pH 7.6, 30C
-
competitive inhibition
-
depressed activity
-
noncompetitive with Ala-2-naphthylamide, competitive with Ala-Ala-Ala
-
competitive inhibitor, 0.14 mM: 90% of maximal activity, 0.28 mM: 80% of maximal activity, 0.42 mM: 78% of maximal activity, 0.56 mM: 72% of maximal activity, 0.96 mM: 56% of maximal activity, 1 mM: 50% of maximal activity
-
20% cell growth, 35% viability of cells
-
tryptamine formation
-
heat-purified enzyme, at low concentrations, pH 7-8
-
inhibits transferase activity, no inhibition of biosynthetic activity
-

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (148 results)

EC NUMBER
TURNOVER NUMBER [1/S]
TURNOVER NUMBER MAXIMUM [1/S]
COMMENTARY
LITERATURE
462.5
-
pH 7.0, 40C
12.3
-
in 100 mM Tris-HCl, pH 9.0, at 25C
0.205
-
pH 9.0, 25C
12.3
-
pH 7.0, temperature not specified in the publication
2.2
-
pH 8.0, 25C
970
-
pH 8.0, 25C
343
-
pH 5.0, 40C
0.7
-
at pH 7.9

KM Value (337 results)

EC NUMBER
KM VALUE [MM]
KM VALUE MAXIMUM [MM]
COMMENTARY
LITERATURE
0.0518
-
pH 7.0, 40C
1
-
in 100 mM Tris-HCl, pH 9.0, at 25C
1
-
pH 9.0, 25C
5.8
-
-
3.8
-
pH 8.0, 37C
1
-
with 2-oxoisohexanoate, pH 8.0, 30C
0.5
-
pH 7.0, temperature not specified in the publication
0.82
-
pH 8.0, 25C
2.01
-
recombinant enzyme, in 10 mM phosphate buffer (pH 7.4), 50 mM pyridoxal 5'-phosphate, at 37C
0.033
-
pH 7.0, 37C
0.033
-
pH 7, 37C
1.3
-
-
2.1
-
-

Ki Value (48 results)

EC NUMBER
KI VALUE [MM]
KI VALUE MAXIMUM [MM]
COMMENTARY
LITERATURE
1.75
-
-
3.2
-
at pH 7.0 and 55C
3.2
-
-
0.3
-
competitive vs. iron
1.75
-
at 25C
0.009
-
competitive inhibition with respect to substrate and noncompetitively with respect to cofactor
0.25
-
-
0.2
-
pH 8.0, 30C
0.034
-
70C, pH 7.6

IC50 Value (2 results)

EC NUMBER
IC50 VALUE
IC50 VALUE MAXIMUM
COMMENTARY
LITERATURE
0.00038
-
-
0.00038
-
at 25C

References & Links