Ligand L-tyrosine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-tyrosine (click for magnification)
Molecular Formula
4-hydroxy-L-phenylalanine, L-hydroxyphenylalanine, L-Tyr, L-tyrosine[side 2], p-L-Tyr, p-tyrosine, Tyr, tyrosin, tyrosine, Y
Pathway Source
(S)-reticuline biosynthesis I, (S)-reticuline biosynthesis II, 3-(4-hydroxyphenyl)pyruvate biosynthesis, 3-amino-4,7-dihydroxy-coumarin biosynthesis, 3PG-factor 420 biosynthesis more

Show all pahtways known for Show all BRENDA pathways known for L-tyrosine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (60 results)

L-tyrosine + O2 = ? + H2O2
show the reaction diagram
L-tyrosine + H2O2 = L-dopa + H2O
show the reaction diagram
L-tyrosine + NADPH + H+ + ATP = L-tyrosinal + NADP+ + AMP + diphosphate
show the reaction diagram
S-adenosyl-L-methionine + L-tyrosine = S-adenosyl-L-homocysteine + 3-methyl-L-tyrosine
show the reaction diagram
dimethylallyl diphosphate + L-tyrosine = diphosphate + 4-O-dimethylallyl-L-tyrosine
show the reaction diagram
5-amino-6-(D-ribitylamino)uracil + L-tyrosine + S-adenosyl-L-methionine = 5-amino-5-(4-hydroxybenzyl)-6-(D-ribitylimino)-5,6-dihydrouracil + 2-iminoacetate + L-methionine + 5'-deoxyadenosine
show the reaction diagram
L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate
show the reaction diagram
4-hydroxybenzoylformate + L-tyrosine = (2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate
show the reaction diagram
L-tyrosine + O2 + H2O = (4-hydroxyphenyl)acetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
Tyrosine = ?
show the reaction diagram
L-tyrosine + H2O = phenol + pyruvate + NH3
show the reaction diagram
L-tyrosine + D-ribulose 5-phosphate = (2S)-3-(4-hydroxyphenyl)-2-isocyanopropanoate + hydroxyacetone + formaldehyde + phosphate + H2O
show the reaction diagram
L-tyrosine = trans-p-hydroxycinnamate + NH3
show the reaction diagram
L-tyrosine = trans-p-hydroxycinnamate + NH3
show the reaction diagram
ATP + L-tyrosine + tRNAPhe = AMP + diphosphate + L-tyrosinyl-tRNAPhe
show the reaction diagram
ATP + L-tyrosine + L-arginine = L-tyrosyl-L-arginine + AMP + diphosphate
show the reaction diagram

In Vivo Product in Enzyme-catalyzed Reactions (24 results)

3-iodo-L-tyrosine + NADPH + H+ = L-tyrosine + NADP+ + I-
show the reaction diagram
L-arogenate + NAD+ = L-tyrosine + NADH + CO2
show the reaction diagram
(2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate = 4-hydroxybenzoylformate + L-tyrosine
show the reaction diagram
L-Tyr benzyl ester + H2O = benzyl alcohol + L-tyrosine
show the reaction diagram
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
phosphotyrosine + H2O = tyrosine + phosphate
show the reaction diagram
Leu-Tyr + H2O = Leu + Tyr
show the reaction diagram
alpha-tubulin + H2O = detyrosinated tubulin + Tyr
show the reaction diagram
profilin + H2O = L-tyrosine + ?
show the reaction diagram
show the reaction diagram
show the reaction diagram
ATP + H2O + L-tyrosinyl-[tyrosine-binding protein][side 1] = ADP + phosphate + L-tyrosine[side 2] + [tyrosine-binding protein][side 1]
show the reaction diagram

Substrate in Enzyme-catalyzed Reactions (299 results)

L-tyrosine + O2 = ? + H2O2
show the reaction diagram
tyrosine + H2O2 + I- = monoiodotyrosine + diiodotyrosine + H2O
show the reaction diagram
L-tyrosine + H2O2 + H+ = ?
show the reaction diagram
L-tyrosine + H2O2 = L-dopa + H2O
show the reaction diagram
L-tyrosine + O2 = 3-(4-hydroxyphenyl)-2-oxopropanoic acid + NH3
show the reaction diagram
L-tyrosine + O2 = 4-hydroxyphenylacetamide + CO2 + H2O
show the reaction diagram
L-tyrosine + 2 O2 + 2 [reduced NADPH-hemoprotein reductase] = (E)-[4-hydroxyphenylacetaldehyde oxime] + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
show the reaction diagram
tyrosine + 2 O2 + 2 [reduced NADPH-hemoprotein reductase] = (E)-4-hydroxyphenylacetaldoxime + 2 [oxidized NADPH-hemoprotein reductase] + CO2 + 3 H2O
show the reaction diagram
L-tyrosine + tetrahydropteridine + O2 = ?
show the reaction diagram
L-tyrosine + ascorbate + O2 = L-dopa + dehydroascorbate + H2O
show the reaction diagram
L-tyrosine + NADPH + H+ + ATP = L-tyrosinal + NADP+ + AMP + diphosphate
show the reaction diagram
L-tyrosine + H2O + NAD+ = (4-hydroxyphenyl)pyruvate + NH3 + NADH
show the reaction diagram
L-Tyr + O2 + H2O = 3-(4-hydroxyphenyl)-2-oxopropionic acid + NH3 + H2O2
show the reaction diagram
L-tyrosine + H2O + 2 cytochrome b = 4-hydroxyphenylpyruvate + NH3 + 2 reduced cytochrome b
show the reaction diagram
S-adenosyl-L-methionine + L-tyrosine = S-adenosyl-L-homocysteine + 3-methyl-L-tyrosine
show the reaction diagram
S-adenosyl-L-methionine + L-tyrosine = S-adenosyl-L-homocysteine + ?
show the reaction diagram
p-coumaroyl-CoA + L-tyrosine = ? + CoA
show the reaction diagram
5-amino-6-(D-ribitylamino)uracil + L-tyrosine + S-adenosyl-L-methionine = 5-amino-5-(4-hydroxybenzyl)-6-(D-ribitylimino)-5,6-dihydrouracil + 2-iminoacetate + L-methionine + 5'-deoxyadenosine
show the reaction diagram
dimethylallyl diphosphate + L-tyrosine = diphosphate + 5-[(2E)-pent-2-en-1-yl]-L-tryptophan
show the reaction diagram
dimethylallyl diphosphate + L-tyrosine = diphosphate + 3-(3-methylbut-2-enyl)-L-tyrosine
show the reaction diagram
2-oxosuccinamic acid + L-tyrosine = L-asparagine + 3-(4-hydroxyphenyl)-2-oxopropanoate
show the reaction diagram
L-tyrosine + 2-oxoglutarate = (4-hydroxyphenyl)pyruvate + L-glutamate
show the reaction diagram
L-tyrosine + 2-oxoglutarate = 2-oxo-3-phenylpropanoate + L-glutamate
show the reaction diagram
phenylpyruvate + L-tyrosine = phenylalanine + 3-(4-hydroxyphenyl)-2-oxopropanoate
show the reaction diagram
2-oxoglutarate + L-tyrosine = L-glutamate + 4-hydroxyphenylpyruvate
show the reaction diagram
L-tyrosine + 2-oxoglutarate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-glutamate
show the reaction diagram
L-tyrosine + pyruvate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-alanine
show the reaction diagram
tyrosine + glyoxylate = 3-(4-hydroxyphenyl)-2-oxopropanoate + glycine
show the reaction diagram
tyrosine + glyoxylate = 3-(4-hydroxyphenyl)-2-oxopropanoate + glycine
show the reaction diagram
L-tyrosine + indole-3-pyruvic acid = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-tryptophan
show the reaction diagram
3'-phosphoadenylylsulfate + L-tyrosine = adenosine 3',5'-bisphosphate + tyrosine O4-sulfate
show the reaction diagram
lactate + L-tyrosine = N-L-lactoyl-L-tyrosine + H2O
show the reaction diagram
L-tyrosine + phenylacetamide = N-(phenylacetyl)-L-tyrosine + NH3
show the reaction diagram
L-tyrosine + O2 + H2O = (4-hydroxyphenyl)acetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-tyrosine + S-adenosyl-L-methionine + reduced acceptor = 2-iminoacetate + 4-methylphenol + 5'-deoxyadenosine + L-methionine + acceptor + 2 H+
show the reaction diagram
L-tyrosine + D-ribulose 5-phosphate = (2S)-3-(4-hydroxyphenyl)-2-isocyanopropanoate + hydroxyacetone + formaldehyde + phosphate + H2O
show the reaction diagram
L-tyrosine = trans-p-hydroxycinnamate + NH3
show the reaction diagram
ATP + L-Tyr + H2O = AMP + diphosphate + D-Tyr
show the reaction diagram

Product in Enzyme-catalyzed Reactions (283 results)

phenylalanine + NAD(P)H + O2 = tyrosine + NAD(P)+ + H2O
show the reaction diagram
L-arogenate + NAD+ = L-tyrosine + NADH + CO2
show the reaction diagram
p-hydroxyphenylpyruvate + NADPH + NH3 = L-tyrosine + NADP+ + H2O
show the reaction diagram
N-methyl-L-tyrosine + O2 + H2O = L-tyrosine + formaldehyde + H2O2
show the reaction diagram
5-L-glutamyl-L-Tyr + Gly-Gly = L-Tyr + 5-L-glutamyl-Gly-Gly
show the reaction diagram
L-aspartate + 4-hydroxyphenylpyruvate = oxaloacetate + L-tyrosine
show the reaction diagram
L-tryptophan + p-hydroxyphenylpyruvate = 3-indole-2-oxopropanoate + tyrosine
show the reaction diagram
L-leucine + p-hydroxyphenylpyruvate = 2-oxoisohexanoate + L-tyrosine
show the reaction diagram
L-kynurenine + hydroxyphenylpyruvate = kynurenic acid + L-tyrosine
show the reaction diagram
4-hydroxyphenylpyruvate + L-aspartate = L-tyrosine + oxaloacetate
show the reaction diagram
4-hydroxyphenylpyruvate + L-glutamate = L-tyrosine + 2-oxoglutarate
show the reaction diagram
(2S)-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate = 4-hydroxybenzoylformate + L-tyrosine
show the reaction diagram
L-Tyr ethyl ester + H2O = L-Tyr + ethanol
show the reaction diagram
Tyr-tRNA + H2O = Tyr + tRNA
show the reaction diagram
L-Tyr benzyl ester + H2O = benzyl alcohol + L-tyrosine
show the reaction diagram
methyl L-tyrosine + H2O = methanol + L-tyrosine
show the reaction diagram
L-phosphotyrosine + H2O = phosphate + L-tyrosine
show the reaction diagram
phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
O-phospho-L-tyrosine + H2O = L-Tyr + phosphate
show the reaction diagram
O-phospho-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
(5'-GATCTAAAAGACTT-3')-phosphotyrosine + H2O = (5'-GATCTAAAAGACTT-3')-phosphate + L-tyrosine
show the reaction diagram
Tyr-O-sulfate + H2O = Tyr + sulfate
show the reaction diagram
tyrosine O-sulfate + H2O = tyrosine + sulfate
show the reaction diagram
L-tyrosine-7-amido-4-methylcoumarin + H2O = L-tyrosine + 7-amino-4-methylcoumarin
show the reaction diagram
Tyr-Gly-Gly-Phe-Leu + H2O = Tyr + Gly-Gly-Phe-Leu
show the reaction diagram
L-Tyr-2-naphthylamide + H2O = L-Tyr + 2-naphthylamine
show the reaction diagram
beta-homoVal-beta-homoIle-Tyr + H2O = beta-homoVal + beta-homoIle + Tyr
show the reaction diagram
L-Tyr-7-amido-4-methylcoumarin + H2O = L-Tyr + 7-amino-4-methylcoumarin
show the reaction diagram
Tyr-7-amido-4-methylcoumarin + H2O = Tyr + 7-amino-4-methylcoumarin
show the reaction diagram
Gly-Tyr + H2O = Gly + Tyr
show the reaction diagram
Ala-Tyr + H2O = Ala + Tyr
show the reaction diagram
Ser-Tyr-NH2 + H2O = Ser + Tyr + NH3
show the reaction diagram
Tyr-Gly-Gly + H2O = Tyr + Gly-Gly
show the reaction diagram
L-tyrosyl-L-glutamic acid + H2O = tyrosine + glutamate
show the reaction diagram
Carbobenzoxy-Phe-Tyr + H2O = Carbobenzoxy-Phe + Tyr
show the reaction diagram
neurotensin(1-11) + H2O = pELYENKPRRP + Tyr
show the reaction diagram
Benzyloxycarbonyl-Glu-Tyr + H2O = Benzyloxycarbonyl-Glu + Tyr
show the reaction diagram
Tyr-Ala + H2O = Tyr + Ala
show the reaction diagram
pyroglutamyl-Tyr + H2O = pyroglutamate + Tyr
show the reaction diagram
L-Tyr ethyl ester + H2O = L-Tyr + ethanol
show the reaction diagram
L-Tyr-4-nitroanilide + H2O = L-Tyr + 4-nitroaniline
show the reaction diagram
neuropeptide Y3-36 + H2O = neuropeptide Y3-35 + L-tyrosine
show the reaction diagram
N-benzyloxycarbonyl-Gly-Pro-Tyr + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Tyr
show the reaction diagram
casein + H2O = L-tyrosine + ?
show the reaction diagram
L-tyrosine-p-nitroanilide + H2O = L-tyrosine + 4-nitroaniline
show the reaction diagram
show the reaction diagram
show the reaction diagram
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
N,N-dimethyl-casein + H2O = L-tyrosine + ?
show the reaction diagram
show the reaction diagram
Benzyloxycarbonyl-Glu-Tyr + H2O = Benzyloxycarbonyl-Glu + Tyr
show the reaction diagram
pTLRTKL + H2O = phospho-Thr-Leu-Arg + L-tyrosine + Lys-Leu
show the reaction diagram
casein + H2O = L-tyrosine + ?
show the reaction diagram
show the reaction diagram
insulin chain B fragment 22-30 + H2O = RGFF + Tyr + TPKA
show the reaction diagram
L-tyrosine amide + H2O = L-tyrosine + NH3
show the reaction diagram
N-acetyl-L-tyrosine + H2O = acetate + L-tyrosine
show the reaction diagram
L-Leu-L-Tyr + H2O = Leu + Tyr
show the reaction diagram
N-acetyltyrosine + H2O = acetate + tyrosine
show the reaction diagram
Nalpha-benzyloxycarbonyl-L-Tyr + H2O = benzyl alcohol + CO2 + L-Tyr
show the reaction diagram
O-phospo-L-tyrosine + H2O = L-tyrosine + phosphate
show the reaction diagram
4-hydroxy-trans-cinnamate + NH3 = 4-hydroxy-L-phenylalanine
show the reaction diagram
5-L-glutamyl-L-tyrosine = 5-oxoproline + L-tyrosine
show the reaction diagram
AMP + diphosphate + L-tyrosyl-tRNATyr = ATP + L-tyrosine + tRNATyr
show the reaction diagram
alpha-tubulin + ADP + phosphate = ATP + detyrosinated alpha-tubulin + L-tyrosine
show the reaction diagram
ATP + H2O + L-tyrosinyl-[tyrosine-binding protein][side 1] = ADP + phosphate + L-tyrosine[side 2] + [tyrosine-binding protein][side 1]
show the reaction diagram

Activator in Enzyme-catalyzed Reactions (23 results)

activates the enzyme
stimulates conversion of prostaglandin G1 to H1
slightly enhancing the activity
slightly enhanced activity
5 mM, 1.41fold activation
expression increases in response to
exposure of 4-week old plants to L-tyrosine at 0.01 or 0.1 mM significantly increases enzyme activity and increases free tyrosine content, while free phenylalanine content decreases. Tyrosine has no effect on coumarin accumulation

Inhibitor in Enzyme-catalyzed Reactions (120 results)

able to prevent the formation of the tubulin/aldose reductase complex and the activation of aldose reductase by tubulin
80% inhibition at 5 mM
noncompetitive vs. L-tryptophan and (6R)-L-erythro-5,6,7,8-tetrahydrobiopterin
uncompetitive inhibition
pH 7.6, 30°C
competitive inhibition
depressed activity
noncompetitive with Ala-2-naphthylamide, competitive with Ala-Ala-Ala
heat-purified enzyme, at low concentrations, pH 7-8
inhibits transferase activity, no inhibition of biosynthetic activity
20% cell growth, 35% viability of cells

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (196 results)

pH 7.0, 40°C
in 100 mM Tris-HCl, pH 9.0, at 25°C
pH 9.0, 25°C
at pH 8.0 and 37°C
pH 8, 25°C
pH 7.0, temperature not specified in the publication
pH 8.0, 25°C
pH 8.0, 25°C
at pH 7.9

KM Value (402 results)

pH 7.0, 40°C
in 100 mM Tris-HCl, pH 9.0, at 25°C
pH 9.0, 25°C
at pH 8.0 and 37°C
pH 8, 25°C
pH 8.0, 37°C
with 2-oxoisohexanoate, pH 8.0, 30°C
pH 7.0, temperature not specified in the publication