Ligand Ala-Gly

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of Ala-Gly (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C5H10N2O3
Ala-Gly
CXISPYVYMQWFLE-VKHMYHEASA-N
Synonyms:
Alanylglycine, L-Ala-Gly, l-alanyl-glycine, L-alanylglycine

Roles as Enzyme Ligand

Substrate in Enzyme-catalyzed Reactions (11 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
5-L-glutamyl-4-nitroanilide + L-alanylglycine = 4-nitroaniline + 5-L-glutamyl-L-alanylglycine
show the reaction diagram
-
Ala-Gly + H2O = Ala + Gly
show the reaction diagram
-
Ala-Gly + H2O = Ala + Gly
show the reaction diagram
-
Ala-Gly + H2O = Ala + Gly
show the reaction diagram
-
L-Ala-Gly + H2O = L-Ala + Gly
show the reaction diagram
-
L-Ala-Gly + H2O = L-Ala + Gly
show the reaction diagram
-
Ala-Gly = Ala-Gly-Ala-Gly + H2O
show the reaction diagram
-

Product in Enzyme-catalyzed Reactions (2 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
Ala-Gly-Phe-Ala + H2O = Ala-Gly + Phe-Ala
show the reaction diagram
-
-
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O = Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
show the reaction diagram
-
-

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (1 result)

EC NUMBER
TURNOVER NUMBER [1/S]
TURNOVER NUMBER MAXIMUM [1/S]
COMMENTARY
LITERATURE
43.3
-
-

KM Value (4 results)

EC NUMBER
KM VALUE [MM]
KM VALUE MAXIMUM [MM]
COMMENTARY
LITERATURE
3.4
-
-
40
-
-
3.3
-
-
0.8
-
-

References & Links

Links to other databases for Ala-Gly

ChEBI
PubChem
-
PubChem