Ligand LGPHAIDNHRS

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of LGPHAIDNHRS (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C51H81N19O16
LGPHAIDNHRS
IVSQHIOUECBJBO-RNZNOLCMSA-N

Roles as Enzyme Ligand

Product in Enzyme-catalyzed Reactions (1 result)

EC NUMBER
LITERATURE
REACTION DIAGRAM
REACTION
ENZYME 3D STRUCTURE
-
show the reaction diagram
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O = Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
-

Enzyme Kinetic Parameters

Links to other databases for LGPHAIDNHRS

ChEBI
PubChem
-
PubChem