Ligand GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C146H213N43O40
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2
SLZIZIJTGAYEKK-CIJSCKBQSA-N

Roles as Enzyme Ligand

Substrate in Enzyme-catalyzed Reactions (1 result)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O = Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
show the reaction diagram
-

Enzyme Kinetic Parameters

References & Links

Links to other databases for GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2

ChEBI
PubChem
-
PubChem