Ligand LVCG

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of LVCG (click for magnification)
Molecular Formula

Roles as Enzyme Ligand

Product in Enzyme-catalyzed Reactions (1 result)

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram

Enzyme Kinetic Parameters

Links to other databases for LVCG
