Ligand LCGSH

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of LCGSH (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
C20H33N7O7S
LCGSH
JEMMOVATDCRYPC-UHFFFAOYSA-N

Roles as Enzyme Ligand

Product in Enzyme-catalyzed Reactions (1 result)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
-
-

Enzyme Kinetic Parameters

Links to other databases for LCGSH

ChEBI
PubChem
-
PubChem