print visible entries

print all entries

Ligand VNQH

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure

Picture of VNQH (click for magnification)

C₂₀H₃₂N₈O₇

VNQH

PLHGNHAIKNNYAT-UHFFFAOYSA-N

close all tables

close all tables

open all tables

open all tables

Roles as Enzyme Ligand

Product in Enzyme-catalyzed Reactions (1 result)

back to the top

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA

show the reaction diagram

-

Enzyme Kinetic Parameters

References & Links

back to the top

top

show table

Show Reference (0 entries)

Links to other databases for VNQH

back to the top

-

Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.

Release 2023.1 (January 2023)