Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
L-leucine + 2,6-dichlorophenolindophenol = ? + reduced 2,6-dichlorophenolindophenol
-
L-leucine + O2 = ? + H2O2
-
L-leucine + 2-oxoglutarate + O2 = 4-hydroxy-L-leucine + succinate + CO2
-
L-leucine + 2-oxoglutarate + O2 = ?
-
L-leucine + H2O + NAD+ = 4-methyl-2-oxopentanoate + NH3 + NADH
-
L-leucine + H2O + NAD+ = 2-oxo-iso-valerate + NH3 + NADH + H+
-
L-leucine + H2O + NAD+ = 2-oxoisovalerate + NH3 + NADH + H+
-
L-Leu + H2O + NAD+ = 3-methyl-2-oxopentanoic acid + NH3 + NADH
-
L-leucine + H2O + NAD+ = 3,3-dimethyl-2-oxo-butanoate + NH3 + NADH
-
L-leucine + H2O + NAD+ = 2-oxoisocaproate + NADH + NH3
-
L-leucine + H2O + NAD+ = 2-oxoisohexanoate + NH3 + NADH + H+
-
L-leucine + H2O + NAD+ = ? + NH3 + NADH
-
L-leucine + H2O + NAD+ = 2-oxoisocaproate + NADH + NH3
-
L-Leu + H2O + 3-acetylpyridine-deamino-NAD+ = 4-methyl-2-oxopentanoate + NH3 + 3-acetylpyridine-deamino-NADH
-
L-Leu + H2O + 3-acetylpyridine-NAD+ = 4-methyl-2-oxopentanoate + NH3 + 3-acetylpyridine-NADH
-
L-Leu + H2O + 3-pyridinealdehyde-NAD+ = 4-methyl-2-oxopentanoate + NH3 + 3-pyridinealdehyde-NADH
-
L-Leu + H2O + deamino-NAD+ = 4-methyl-2-oxopentanoate + NH3 + deamino-NADH
-
L-Leu + H2O + NAD+ = 4-methyl-2-oxopentanoate + NH3 + NADH
349665, 349660, 349663, 349666, 349671, 349697, 349698, 349699, 656569, 349647, 349662, 349669, 349674, 349676, 349687, 349689, 349690, 349691, 349694, 349554, 349667, 349668, 349672, 349673, 349675, 349688, 349692, 349693, 349658, 349661, 349670, 349678, 349679, 349684, 349680, 349681, 349695, 349696, 349682, 349664, 349685, 349686, 656565, 349659, 695691
-
L-Leu + H2O + thionicotinamide-NAD+ = 4-methyl-2-oxopentanoate + NH3 + thionicotinamide-NADH
-
L-leucine + H2O + NAD+ = 4-methyl-2-oxopentanoate + NH3 + NADH + H+
-
L-leucine + H2O + NADP+ = 4-methyl-2-oxopentanoate + NH3 + NADPH + H+
-
L-leucine + O2 + H2O = 4-methyl-2-oxopentanoate + NH3 + H2O2
-
L-Leu + H2O + O2 = 2-oxo-4-methylvaleric acid + NH3 + H2O2
741737, 742687, 742813, 743872, 742047, 741736, 743869, 742670, 742690, 743849, 711329, 741749, 743013, 742930, 741725
-
L-Leu + H2O + O2 = 4-methyl-2-oxopentanoate + NH3 + H2O2
-
L-Leu + H2O + O2 = 4-methyl-2-oxopentanoic acid + NH3 + H2O2
-
L-leucine + H2O + O2 = 2-oxo-4-methylpentanoate + NH3 + H2O2
-
L-leucine + H2O + O2 = 2-oxo-4-methylvaleric acid + NH3 + H2O2
-
L-leucine + H2O + O2 = 4-methyl-2-oxo-pentanoate + NH3 + H2O2
-
L-leucine + H2O + O2 = 4-methyl-2-oxo-pentanoic acid + NH3 + H2O2
-
L-leucine + H2O + O2 = 4-methyl-2-oxopentanoate + NH3 + H2O2
-
L-leucine + H2O + O2 = 4-methyl-2-oxopentanoic acid + NH3 + H2O2
391789, 724397, 391769, 391802, 391784, 391815, 391819, 695276, 694300, 690221, 391820, 391824, 670964, 695208, 692288, 695209, 726521, 763758, 691918, 391768, 391770, 391773, 391823, 391821, 651026, 670798, 670968, 667933, 692650, 690575, 690684, 694317
-
L-leucine + H2O + 2 cytochrome b = 2-oxo-4-methylpentanoate + NH3 + 2 reduced cytochrome b
-
L-Leu + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Leu + NAD+
-
L-leucine + 2,6-dichlorophenolindophenol + H2O = ? + reduced 2,6-dichlorophenolindophenol
-
acetyl-CoA + L-leucine = CoA + N-acetyl-L-leucine
-
propionyl-CoA + L-leucine = CoA + propionyl-L-leucine
-
5-L-glutamyl-4-nitroanilide + L-Leu = 4-nitroaniline + 5-L-glutamyl-L-Leu
-
5-L-glutamyl-4-nitroanilide + L-leucine = 4-nitroaniline + 5-L-glutamyl-L-leucine
-
L-gamma-glutamyl-4-nitroanilide + L-leucine = 4-nitroaniline + 5-L-glutamyl-L-leucine
-
L-glutamine + L-leucine = gamma-glutamyl-L-leucine + NH3
-
5-L-glutamyl-4-nitroanilide + Leu = 4-nitroaniline + 5-L-glutamyl-Leu
-
pyruvate + L-leucine = alanine + 4-methyl-2-oxopentanoate
-
2-oxosuccinamic acid + L-leucine = L-asparagine + 4-methyl-2-oxopentanoate
-
L-leucine + 2-oxoglutarate = 2-oxo-4-methylpentanoate + L-glutamate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
2-oxo-3-indolylpropanoate + L-leucine = L-tryptophan + 4-methyl-2-oxovalerate
-
2-oxobutyrate + L-leucine = 2-aminobutyrate + 4-methyl-2-oxovalerate
-
2-oxoglutarate + L-leucine = L-glutamate + 4-methyl-2-oxopentanoate
-
3-methyl-2-oxopentanoate + L-leucine = L-isoleucine + 4-methyl-2-oxovalerate
-
4-methyl-2-oxopentanoate + L-leucine = L-leucine + 4-methyl-2-oxovalerate
-
L-leucine + 2-oxo-3-methiobutyrate = 2-oxoisohexanoate + L-methionine
-
L-leucine + 2-oxo-3-methylpentanoate = 2-oxoisohexanoate + L-isoleucine
-
L-leucine + 2-oxo-butyrate = 2-oxoisohexanoate + 2-aminobutyrate
-
L-leucine + 2-oxo-hexanoate = 2-oxoisohexanoate + 2-aminohexanoate
-
L-leucine + 2-oxo-isohexanoate = 2-oxoisohexanoate + L-leucine
-
L-leucine + 2-oxo-pentanoate = 2-oxoisohexanoate + 2-aminopentanoate
-
L-leucine + 2-oxobutanoate = 2-oxoisohexanoate + L-valine
-
L-leucine + 2-oxobutyrate = 4-methyl-2-oxopentanoate + 2-aminobutyrate
-
L-leucine + 2-oxoglutarate = 2-oxoisohexanoate + L-glutamate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
640020, 673846, 639992, 640005, 640012, 640016, 640030, 640021, 640025, 640029, 640038, 640039, 640042, 675563, 640013, 640031, 640009, 672847, 639993, 639996, 640017, 640019, 640023, 640037, 640044, 639995, 639997, 673758, 640033, 639998, 640026, 640028, 640034, 640006, 676421, 640027, 640032, 758768, 640004, 758688, 640040, 671284, 639999, 640003, 640041, 640011, 636660, 33983, 671131, 640001, 674728, 758607, 758657, 758690, 759639, 759733, 677188, 758558, 758794, 759528, 672589, 758728, 759531, 759947, 758848, 759127, 640015, 661957
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoic acid + L-glutamate
-
L-leucine + 2-oxoglutarate = L-glutamate + 4-methyl-2-oxopentanoate
-
L-leucine + 2-oxohexanoate = 2-oxoisohexanoate + 2-aminohexanoate
-
L-leucine + 2-oxohexanoic acid = 4-methyl-2-oxopentanoate + 2-aminohexanoic acid
-
L-leucine + 2-oxoisohexanoate = 2-oxoisohexanoate + L-leucine
-
L-leucine + 2-oxoisopentanoate = 2-oxoisohexanoate + L-valine
-
L-leucine + 2-oxoisovaleric acid = 4-methyl-2-oxopentanoate + 2-aminoisovaleric acid
-
L-leucine + 2-oxooctanoate = 2-oxoisohexanoate + 2-aminooctanoate
-
L-leucine + 3-methyl-2-oxobutanoate = 4-methyl-2-oxopentanoate + L-valine
-
L-leucine + 3-methyl-2-oxopentanoate = 2-oxo-4-methylpentanoate + L-isoleucine
-
L-leucine + 3-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-isoleucine
-
L-leucine + 4-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-leucine
-
L-leucine + 4-methyl-2-oxovalerate = 4-methyl-2-oxopentanoate + L-leucine
-
L-leucine + 4-methylthio-2-oxo-butanoate = 4-methyl-2-oxopentanoate + L-methionine
-
L-leucine + DL-2-oxo-3-methylpentanoate = 2-oxoisohexanoate + L-isoleucine
-
L-leucine + glyoxylate = 2-oxoisohexanoate + glycine
-
L-leucine + oxaloacetate = 2-oxoisohexanoate + L-asparagine
-
L-leucine + p-hydroxyphenylpyruvate = 2-oxoisohexanoate + L-tyrosine
-
L-leucine + phenylpyruvate = 2-oxoisohexanoate + L-phenylalanine
-
L-leucine + prephenate = 2-oxoisohexanoate + 1-(2-amino-2-carboxyethyl)-4-hydroxycyclohexa-2,5-diene-1-carboxylic acid
-
L-leucine + pyruvate = 2-oxoisohexanoate + L-alanine
-
L-leucine + pyruvate = 4-methyl-2-oxopentanoate + L-alanine
-
pyruvate + L-leucine = L-alanine + 4-methyl-2-oxovalerate
-
L-leucine + glyoxylate = 4-methyl-2-oxopentanoate + glycine
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoic acid + L-glutamate
-
L-leucine + phenylpyruvate = 4-methyl-2-oxopentanoate + L-phenylalanine
-
L-leucine + pyruvate = 4-methyl-2-oxopentanoate + L-alanine
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + indole pyruvate = 4-methyl-2-oxopentanoate + L-tryptophan
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + 4-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-leucine
-
L-leucine + oxaloacetate = 4-methyl-2-oxopentanoate + L-aspartate
-
L-leucine + glyoxylate = 4-methyl-2-oxopentanoate + glycine
-
L-leucine + phenylpyruvate = 4-methyl-2-oxopentanoate + L-phenylalanine
-
phenylpyruvate + L-leucine = ?
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + 2-oxobutanoate = 2-oxoisocaproate + 2-aminobutanoate
-
L-leucine + 2-oxobutanoate = alpha-ketoleucine + 2-aminobutanoate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + pyruvate = 4-methyl-2-oxopentanoate + L-alanine
-
2-oxo-4-methylthiobutanoate + L-leucine = L-methionine + 2-oxo-isocaproate
-
L-leucine + a 2-oxo acid = 2-oxo-4-methylthiobutanoate + an L-amino acid
-
L-leucine + a 2-oxo acid = ?
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + indole-3-pyruvic acid = 2-oxo-4-methylpentanoate + L-tryptophan
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + D-glutamate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
-
Leu + Met = substance P
-
Phe + Leu = Gly + Gly + Gly
-
benzyloxycarbonyl-Glu-methyl ester + leucine = benzyloxycarbonyl-Glu-Leu + methanol
-
L-Leu = 3-Methylbutylamine + CO2
-
L-Leu = 3-Methylbutylamine + CO2
-
2-Oxobutanoate + L-Leu = ?
-
L-Leu = 3-Hydroxy-2-oxopropionate + NH3
-
L-leucine + alpha-ketoglutarate = ?
-
ATP + L-leucine + tRNAPhe = AMP + diphosphate + L-leucyl-tRNAPhe
-
2'-dATP + L-leucine + tRNALeu = 2'-dAMP + diphosphate + L-leucyl-tRNALeu
-
3'-dATP + L-leucine + tRNALeu = 3'-dAMP + diphosphate + L-leucyl-tRNALeu
-
8-azaadenosine 5'-triphosphate + L-leucine + tRNALeu = 8-azaadenosine 5'-monophosphate + diphosphate + L-leucyl-tRNALeu
-
8-bromoadenosine 5'-triphosphate + L-leucine + tRNALeu = 8-bromoadenosine 5'-monophosphate + diphosphate + L-leucyl-tRNALeu
-
8-methylaminoadenosine 5'-triphosphate + L-leucine + tRNALeu = 8-methylaminoadenosine 5'-monophosphate + diphosphate + L-leucyl-tRNALeu
-
Adenosine 5'-O-(3-thio)triphosphate + L-leucine + tRNALeu = adenosine 5'-monophosphate + thiodiphosphate + L-leucyl-tRNALeu
-
Adenylyl beta,gamma-imido diphosphonate + L-leucine + tRNALeu = Adenylic acid + imido-diphosphate + L-leucyl-tRNALeu
-
ATP + L-leucine + Natrialba magadii tRNALeu(CAA) = AMP + diphosphate + L-leucyl-Natrialba magadii tRNALeu(CAA)
-
ATP + L-leucine + Natrialba magadii tRNALeu(GAG) = AMP + diphosphate + L-leucyl-Natrialba magadii tRNALeu(GAG)
-
ATP + L-leucine + Pyrococcus horikoshii tRNALeu(GAG) = AMP + diphosphate + L-leucyl-Pyrococcus horikoshii tRNALeu(GAG)
-
ATP + L-leucine + tRNACAALeu = AMP + diphosphate + L-leucyl-tRNAUAALeu
-
ATP + L-leucine + tRNACAGLeu = AMP + diphosphate + L-leucyl-tRNACAGLeu
-
ATP + L-leucine + tRNAGAGLeu = AMP + diphosphate + L-leucyl-tRNAGAGLeu
-
ATP + L-leucine + tRNAIle = AMP + diphosphate + L-leucyl-tRNALeu
-
ATP + L-leucine + tRNALeu = ?
-
ATP + L-leucine + tRNALeu = AMP + diphosphate + L-leucyl-tRNALeu
435, 416, 438, 652046, 419, 421, 425, 444, 672507, 649136, 715277, 418, 429, 443, 531, 649867, 649992, 650024, 650097, 650221, 653045, 653716, 660871, 661190, 672235, 672244, 672252, 672264, 674619, 693628, 703196, 653192, 653766, 662416, 716384, 727276, 727281, 727364, 151, 424, 428, 675436, 274, 427, 432, 433, 434, 442, 417, 440, 441, 674875, 439, 702063, 702272, 714086, 714087, 715854, 652803, 728402, 662641, 672250, 649605, 651299, 652320, 662245, 672106, 677102, 704595, 728409, 650328, 728693, 693109, 702347, 744654, 745321, 745458, 746422, 726909, 745503, 745556, 744849, 745112, 422, 420, 436, 426, 437, 661018, 662970, 674686, 694435
-
ATP + L-leucine + tRNALeu from Aquifex aeolicus = AMP + diphosphate + L-leucyl-tRNALeu
-
ATP + L-leucine + tRNALeu from Escherichia coli = AMP + diphosphate + L-leucyl-tRNALeu
-
ATP + L-leucine + tRNALeu(GAG) = AMP + diphosphate + L-leucyl-tRNALeu(GAG)
-
ATP + L-leucine + tRNALeu(UAA) = AMP + diphosphate + L-leucyl-tRNALeu(UAA)
-
ATP + L-leucine + tRNALeu(UAG) = AMP + diphosphate + L-leucyl-tRNALeu(UAG)
-
ATP + L-leucine + tRNALeu(UUR) = AMP + diphosphate + L-leucyl-tRNALeu(UUR)
-
ATP + L-leucine + tRNALeuA35G = AMP + diphosphate + L-leucyl-tRNALeuA35G
-
ATP + L-leucine + tRNALeuA73 = AMP + diphosphate + L-leucyl-tRNALeuA73
-
ATP + L-leucine + tRNALeuA73G = AMP + diphosphate + L-leucyl-tRNALeuA73G
-
ATP + L-leucine + tRNALeuCUN = AMP + diphosphate + L-leucyl-tRNALeuCUN
-
ATP + L-leucine + tRNALeuGAG = AMP + diphosphate + L-leucyl-tRNALeuGAG
-
ATP + L-leucine + tRNALeuU73 = AMP + diphosphate + L-leucyl-tRNALeuU73
-
ATP + L-leucine + tRNALeuUUR = AMP + diphosphate + L-leucyl-tRNALeuUUR
-
ATP + L-leucine + tRNASer mutant = AMP + diphosphate + L-leucyl-tRNASer mutant
-
ATP + L-leucine + tRNAUAALeu = AMP + diphosphate + L-leucyl-tRNACAALeu
-
ATP + L-leucine + tRNAUAALeu = AMP + diphosphate + L-leucyl-tRNAUAALeu
-
tubercidin 5'-triphosphate + L-leucine + tRNALeu = tubercidin 5'-phosphate + diphosphate + L-leucyl-tRNALeu
-
ATP + L-leucine + tRNALys = AMP + L-leucyl-tRNALys + diphosphate
-
ATP + L-leucine + [CmaA-protein-T-domain]-4'-phosphopantetheine = AMP + diphosphate + S-L-leucyl-[CmaA-protein-T-domain]-4'-phosphopantetheine
-
ATP + L-Glu + L-leucine = ADP + phosphate + gamma-L-Glu-L-leucine
-
ATP + L-arginine + leucine = ? + AMP
-
ATP + L-tyrosine + leucine = ? + AMP
-
ATP + 3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-L-alanine + L-leucine = ADP + phosphate + 3-(((2E)-4-amino-4-oxobut-2-enoyl)amino)-L-alanyl-L-leucine
-
ATP + L-asparagine + L-leucine = ADP + phosphate + L-asparaginyl-L-leucine
-
ATP + L-aspartate + L-leucine = ADP + phosphate + L-aspartyl-L-leucine
-
ATP + L-glutamine + L-leucine = ADP + phosphate + L-glutaminyl-L-leucine
-
ATP + L-leucine + an L-amino acid = ADP + phosphate + L-leucyl-L-amino acid
-
ATP + L-leucine + beta-alanine = ADP + phosphate + beta-alanyl-L-leucine
-
ATP + L-leucine + glycine = ADP + phosphate + L-leucyl-glycine
-
ATP + L-leucine + L-alanine = ADP + phosphate + L-leucyl-L-alanine
-
ATP + L-leucine + L-isoleucine = ADP + phosphate + L-leucyl-L-isoleucine
-
ATP + L-leucine + L-serine = ADP + phosphate + L-leucyl-L-serine
-
ATP + L-methionine + L-leucine = ADP + phosphate + L-methionyl-L-leucine
-
ATP + L-phenylalanine + L-leucine = ADP + phosphate + L-phenylalanyl-L-leucine
-
ATP + L-proline + L-leucine = ADP + phosphate + L-prolyl-L-leucine
-
ATP + L-tryptophan + L-leucine = ADP + phosphate + L-tryptophyl-L-leucine
-
ATP + glutamic acid + leucine = ADP + phosphate + ?
-
ATP + leucine + alanine = ADP + phosphate + L-leucyl-L-alanine
-
ATP + leucine + cysteine = ADP + phosphate + L-leucyl-L-cysteine
-
ATP + leucine + serine = ADP + phosphate + L-leucyl-L-serine
-
ATP + leucine + threonine = ADP + phosphate + L-leucyl-L-threonine
-
ATP + methionine + leucine = ADP + phosphate + L-methionyl-L-leucine
-
ATP + tryptophan + leucine = ADP + phosphate + L-tryptophanyl-L-leucine
-
ATP + (-)-jasmonate + L-Leu = AMP + diphosphate + jasmonoyl-L-Leu
-
ATP + (2E)-4-[[(2S)-2-amino-2-carboxyethyl]amino]-4-oxobut-2-enoate + L-leucine = ADP + phosphate + N-[(2S)-3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-2-methylpropanoyl]-L-leucine
-
2 ATP + L-Val + 2 L-Leu = 2 ADP + 2 phosphate + L-Val-L-Leu-L-Leu
-
ATP + 2 L-leucine = ADP + phosphate + L-Leu-L-Leu
-
2 ATP + 3 L-leucine = 2 ADP + 2 phosphate + L-Leu-L-Leu-L-Leu
-
3 ATP + 4 L-leucine = 3 ADP + 3 phosphate + L-Leu-L-Leu-L-Leu-L-Leu
-
4 ATP + 5 L-leucine = 4 ADP + 4 phosphate + L-Leu-L-Leu-L-Leu-L-Leu-L-Leu
-
2 ATP + 2 L-Val + L-Leu = 2 ADP + 2 phosphate + L-Val-L-Val-L-Leu
-
ATP + H2O + L-Leu/out = ADP + phosphate + L-Leu/in
-
ATP + H2O + L-leucine/out = ADP + phosphate + L-leucine/in
-
ATP + H2O + L-leucine/out = ADP + phosphate + L-leucine/in
-
ATP + H2O + leucine/out = ADP + phosphate + leucine/in
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
2-oxo-iso-valerate + NADPH + NH3 = L-leucine + NADP+ + H2O
-
2-oxoisohexanoate + NH3 + NADH = L-Leu + NAD+ + H2O
-
4-methyl-2-oxopentanoate + NH3 + NADH + H+ = L-leucine + NAD+ + H2O
-
2-oxoisohexanoate + NH3 + NADH + H+ = L-leucine + H2O + NAD+
-
4-methyl-2-oxopentanoate + NH3 + NADH = L-Leu + H2O + NAD+
-
4-methyl-2-oxopentanoate + NH3 + NADH + H+ = L-leucine + H2O + NAD+
-
alpha-ketoisocaproate + NH3 + NADH + H+ = L-leucine + H2O + NAD+
-
5'-phospho-pyridoxyl-L-leucine + H2O + O2 = pyridoxal 5'-phosphate + L-leucine + H2O2
-
N-(5'-phospho-4'-pyridoxyl)-L-leucine + H2O + O2 = pyridoxal 5'-phosphate + L-leucine + H2O2
-
N-methyl-L-leucine + O2 + H2O = formaldehyde + L-leucine + H2O2
-
fructosyl L-leucine + O2 + H2O = glucosone + L-leucine + H2O2
-
N-methyl-L-leucine + acceptor + H2O = L-leucine + formaldehyde + reduced acceptor
-
5-L-glutamyl-L-leucine + glycylglycine = L-Leu + 5-L-glutamyl-glycylglycine
-
L-aspartate + 2-oxoisocaproate = oxaloacetate + L-leucine
-
L-alanine + 2-oxoisohexanoate = pyruvate + L-leucine
-
L-phenylalanine + 2-oxoisohexanoate = phenylpyruvate + L-leucine
-
L-tryptophan + 2-oxoisohexanoate = 3-indole-2-oxopropanoate + L-leucine
-
2-oxoisocaproate + L-glutamate = L-leucine + 2-oxoglutarate
-
2-methylbenzylamine + 4-methyl-2-oxovalerate = acetophenone + L-leucine
-
2-oxoisocaproate + L-glutamate = L-leucine + 2-oxoglutarate
-
4-methyl-2-oxopentanoate + L-alanine = L-leucine + pyruvate
-
4-methyl-2-oxopentanoate + L-glutamate = L-leucine + 2-oxoglutarate
-
4-methyl-2-oxopentanoate + L-leucine = L-leucine + 4-methyl-2-oxovalerate
-
4-methyl-2-oxopentanoic acid + L-glutamate = L-leucine + 2-oxoglutarate
-
4-methyl-2-oxovaleric acid + L-glutamate = L-leucine + 2-oxoglutarate
-
DL-lysine + 4-methyl-2-oxovalerate = 2-oxo-6-aminohexanoate + L-leucine
-
L-2-aminobutyrate + 4-methyl-2-oxopentanoate = 2-oxobutanoate + L-leucine
-
L-alanine + 2-oxoisohexanoate = pyruvate + L-leucine
-
L-alanine + 4-methyl-2-oxopentanoate = pyruvate + L-leucine
-
L-alanine + 4-methyl-2-oxovalerate = pyruvate + L-leucine
-
L-allo-isoleucine + 2-oxoisohexanoate = 3-methyl-2-oxopentanoate + L-leucine
-
L-aspartate + 2-oxoisohexanoate = oxaloacetate + L-leucine
-
L-cysteine + 4-methyl-2-oxovalerate = 2-oxo-3-thiobutyrate + L-leucine
-
L-glutamate + 2-oxo-isohexanoate = 2-oxoglutarate + L-leucine
-
L-glutamate + 4-methyl-2-oxopentanoate = 2-oxoglutarate + L-leucine
-
L-isoleucine + 2-oxoisocaproate = 3-methyl-2-oxopentanoate + L-leucine
-
L-isoleucine + 2-oxoisohexanoate = 3-methyl-2-oxopentanoate + L-leucine
-
L-isoleucine + 4-methyl-2-oxovalerate = 3-methyl-2-oxopentanoate + L-leucine
-
L-leucine + 2-oxo-isohexanoate = 2-oxoisohexanoate + L-leucine
-
L-leucine + 2-oxoisohexanoate = 2-oxoisohexanoate + L-leucine
-
L-leucine + 4-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-leucine
-
L-leucine + 4-methyl-2-oxovalerate = 4-methyl-2-oxopentanoate + L-leucine
-
L-lysine + 4-methyl-2-oxovalerate = 2-oxo-6-aminohexanoate + L-leucine
-
L-methionine + 2-oxo-isohexanoate = 4-methylsulfanyl-2-oxobutanoate + L-leucine
-
L-methionine + 4-methyl-2-oxovalerate = 4-methylsulfanyl-2-oxobutanoate + L-leucine
-
L-norleucine + 2-oxoisocaproate = 2-oxohexanoate + L-leucine
-
L-norleucine + 4-methyl-2-oxopentanoate = 2-oxohexanoate + L-leucine
-
L-norleucine + 4-methyl-2-oxovalerate = 2-oxohexanoate + L-leucine
-
L-norvaline + 4-methyl-2-oxopentanoate = 2-oxopentanoate + L-leucine
-
L-norvaline + 4-methyl-2-oxovalerate = 2-oxovalerate + L-leucine
-
L-ornithine + 4-methyl-2-oxovalerate = ? + L-leucine
-
L-phenylalanine + 4-methyl-2-oxovalerate = phenylpyruvate + L-leucine
-
L-threonine + 4-methyl-2-oxovalerate = 2-oxo-3-hydroxybutyrate + L-leucine
-
L-valine + 2-oxo-isohexanoate = 2-oxoisopentanoate + L-leucine
-
L-valine + 2-oxoisovalerate = 2-oxoisovalerate + L-leucine
-
L-valine + 4-methyl-2-oxopentanoate = 2-oxoisopentanoate + L-leucine
-
L-valine + 4-methyl-2-oxovalerate = 3-methyl-2-oxobutanoate + L-leucine
-
L-leucine + 4-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-leucine
-
L-glutamine + 2-oxo-4-methyl valerate = 2-oxoglutaramate + L-4-methyl-norvaline
-
L-glutamine + alpha-ketoisocaproate = 2-oxoglutaramate + L-leucine
-
L-kynurenine + 2-oxoisocaproate = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-leucine
-
L-kynurenine + 2-oxoisocaproic acid = 4-(2-aminophenyl)-2,4-dioxobutanoate + L-leucine
-
L-methionine + 2-oxo-isocaproate = 2-oxo-4-methylthiobutanoate + L-leucine
-
4-methyl-2-oxopentanoate + L-alanine = L-leucine + pyruvate
-
4-methyl-2-oxopentanoate + L-asparagine = L-leucine + 2-oxosuccinamic acid
-
4-methyl-2-oxopentanoate + L-glutamate = L-leucine + 2-oxoglutarate
-
(R)-alpha-methylbenzylamine + 4-methyl-2-oxovalerate = acetophenone + L-leucine
-
Leu-tRNA + H2O = Leu + tRNA
-
L-Leu benzyl ester + H2O = L-leu + benzoic acid
-
L-leucine ethyl ester + H2O = L-leucine + ethanol
-
[leu5] enkephalin + H2O = Tyr + Leu
-
L-leucine 2-naphthylamide + H2O = L-leucine + 2-naphthylamine
-
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-Ala-L-Leu + H2O = L-Ala + L-Leu
-
L-His-L-Leu + H2O = L-His + L-Leu
-
L-Leu 7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu beta-naphthylamide + H2O = L-Leu + beta-naphthylamine
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-4-(phenylazo)phenylamide + H2O = L-Leu + 4-(phenylazo)phenylamine
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-7-amido-4-methylcoumarin + H2O = 7-amino-4-methylcoumarin + L-Leu
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-7-amido-4-trifluoro-methylcoumarin + H2O = L-Leu + 7-amino-4-trifluoromethylcoumarin
-
L-Leu-benzyl ester + H2O = L-Leu + benzylalcohol
-
L-Leu-Gly + H2O = L-Leu + Gly
-
L-Leu-L-Arg + H2O = L-Leu + L-Arg
-
L-Leu-L-Asn + H2O = L-Leu + L-Asn
-
L-Leu-L-Asp + H2O = L-Leu + L-Asp
-
L-Leu-L-Leu + H2O = L-Leu + L-Leu
-
L-Leu-L-Met + H2O = L-Leu + L-Met
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
L-Leu-L-Ser + H2O = L-Leu + L-Ser
-
L-Leu-L-Tyr + H2O = L-Leu + L-Tyr
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-leucine-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-Met-L-Leu + H2O = L-Met + L-Leu
-
L-Phe-L-Leu + H2O = L-Phe + L-Leu
-
L-Pro-L-Leu + H2O = L-Pro + L-Leu
-
L-Thr-L-Leu + H2O = L-Thr + L-Leu
-
L-Trp-L-Leu + H2O = L-Trp + L-Leu
-
L-Tyr-L-Leu + H2O = L-Tyr + L-Leu
-
L-Val-L-Leu + H2O = L-Val + L-Leu
-
4-[(E)-2-[4-cyano-5-(dicyanomethylidene)-2,2-dimethyl-2,5-dihydrofuran-3-yl]ethenyl]phenyl L-leucinate + H2O = L-leucine + 4-[(E)-2-(4-aminophenyl)ethenyl-3-cyano-5,5-dimethylfuran-2(5H)-ylidene]propanedinitrile
-
L-Leu-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-Leu-p-nitroanilide + H2O = L-leucine + p-nitroaniline
-
L-leucine 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine amide + H2O = L-leucine + NH3
-
L-leucine hydrazide + H2O = L-leucine + azide
-
L-leucine-4-methylcoumarin-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-4-methylcoumaryl-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-4-methylcoumaryl-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarine
-
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-p-nitroanilide + H2O = L-leucine + p-nitroaniline
-
L-leucinhydrazide + H2O = L-leucine + H2NNH2
-
L-leucyl-2-naphthylamide + H2O = L-leucine + 2-naphthylamine
-
L-leucyl-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucylamide + H2O = L-leucine + NH3
-
L-leucylglycine + H2O = L-leucine + glycine
-
Leu-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
Leu-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu + H2O = L-leucine + Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu
-
Ala-Leu + H2O = Ala + Leu
-
Arg-Leu + H2O = Arg + Leu
-
Asn-Leu + H2O = Asn + Leu
-
Asp-Leu + H2O = Asp + Leu
-
Cys-Leu + H2O = Cys + Leu
-
Gln-Leu + H2O = Gln + Leu
-
Glu-Leu + H2O = Glu + Leu
-
Gly-Leu + H2O = Gly + Leu
-
His-Leu + H2O = His + Leu
-
Ile-Leu + H2O = Ile + Leu
-
kallidin + H2O = Leu + bradykinin
-
Leu 4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu-4-methylcoumaryl-7-amide + H2O = Leu + 7-amino-4-methyl-coumarin
-
Leu-4-methylcoumaryl-7-amide + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-4-trifluoroomethylcoumarin-7-amide + H2O = Leu + 7-amino-4-trifluoromethylcoumarin
-
Leu-7-amido-4-methylcoumarin + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-Arg + H2O = Leu + Arg
-
Leu-Arg-Pro-Gly + H2O = Leu + Arg-Pro-Gly
-
Leu-Asn + H2O = Leu + Asn
-
Leu-Asp + H2O = Leu + Asp
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu + H2O = Leu + Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu
-
Leu-Gly-Gly + H2O = Leu + Gly-Gly
-
Leu-Gly-Tyr-Leu + H2O = Leu + Gly + Tyr + Leu
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Leu-Leu + H2O = Leu + Leu-Leu
-
Leu-Met + H2O = Leu + Met
-
Leu-p-nitroanilide + H2O = Leu + p-nitroaniline
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Ser + H2O = Leu + Ser
-
Leu-systemin + H2O = Leu + systemin
-
Leu-Trp + H2O = Leu + Trp
-
Leu-Tyr + H2O = Leu + Tyr
-
Leu-Val + H2O = Leu + Val
-
Met-Leu + H2O = Met + Leu
-
Phe-Leu + H2O = Phe + Leu
-
Pro-Leu + H2O = Pro + Leu
-
Ser-Leu + H2O = Ser + Leu
-
Thr-Leu + H2O = Thr + Leu
-
Trp-Leu + H2O = Trp + Leu
-
Tyr-Leu + H2O = Tyr + Leu
-
Val-Leu + H2O = Val + Leu
-
L-leucine 4-nitroanilide + H2O = leucine + 4-nitroaniline
-
Leu-2-naphthylamide + H2O = leucine + 2-naphthylamine
-
Leu-7-amido-4-methylcoumarin + H2O = leucine + 7-amino-4-methylcoumarin
-
leucyl-7-amido-4-methylcoumarin + H2O = leucine + 7-amino-4-methylcoumarin
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-7-amido-4-methylcoumarin + H2O = 7-amino-4-methylcoumarin + L-Leu
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-Gly-Gly + H2O = L-Leu + Gly-Gly
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-leucine-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-leucine 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine anilide + H2O = L-leucine + aniline
-
L-leucine ethyl ester + H2O = L-leucine + ethanol
-
L-leucine-4-anisidide + H2O = L-leucine + anisidine
-
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl 7-amido-4-carbamoylmethylcoumarin + H2O = L-leucine + 7-amino-4-carbamoylmethylcoumarin
-
L-leucyl-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl-L-leucyl-L-leucine + H2O = L-leucine + L-leucyl-L-leucine
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Ala + H2O = Leu + Ala
-
Leu-amide + H2O = Leu + NH3
-
Leu-Arg + H2O = Leu + Arg
-
Leu-beta-naphthylamide + H2O = Leu + beta-naphthylamine
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Ile + H2O = Leu + Ile
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Met + H2O = Leu + Met
-
Leu-methyl ester + H2O = Leu + methanol
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Trp + H2O = Leu + Trp
-
Leu-Tyr + H2O = Leu + Tyr
-
Leu-Val + H2O = Leu + Val
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Gly-Gly + H2O = Leu + Gly-Gly
-
Pro-Leu + H2O = Pro + Leu
-
L-leucine-4-methylcoumaryl-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
Ala-Leu + H2O = Ala + Leu
-
Leu-(beta-naphthylamine) + H2O = Leu + naphthylamine
-
Leu-2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu-4-methyl-coumaryl-7-amide + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-7-amido-4-methylcoumarin = Leu + 7-amino-4-methylcoumarin
-
Leu-Ala + H2O = Leu + Ala
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Leu + H2O = Leu + Leu
-
Leu-p-nitroanilide + H2O = Leu + p-nitroaniline
-
L-leucine 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine p-nitroanilide + H2O = L-leucine + p-nitroaniline
-
(Leu)3 + H2O = Leu + Leu-Leu
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-7-amido-4-methylcoumarin + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-Arg-Arg-Ala-Ser-Leu-Gly + H2O = Leu + Arg-Arg-Ala-Ser-Leu-Gly
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Leu-OMe + H2O = Leu + Leu-OMe
-
Lys-Leu + H2O = Lys + Leu
-
Leu-enkephalin + H2O = Leu + enkephalin
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Trp + H2O = Leu + Trp
-
Leu-Trp-Leu + H2O = Leu + Trp-Leu
-
Leu-Trp-Met-Arg + H2O = Leu + Trp-Met-Arg
-
Leu-Tyr + H2O = Leu + Tyr
-
Tyr-Leu + H2O = Tyr + Leu
-
His-Leu + H2O = His + Leu
-
Leu-Ala + H2O = Leu + Ala
-
Leu-amide + H2O = Leu + NH3
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Gly-Gly + H2O = Leu + Gly-Gly
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Trp + H2O = Leu + Trp
-
Phe-Leu + H2O = Phe + Leu
-
Trp-Leu + H2O = Trp + Leu
-
L-leucine-4-methylcoumarin-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroanilide
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-7-amido-4-carbamoylmethylcoumarin + H2O = L-Leu + 7-amino-4-carbamoylmethylcoumarin
-
L-Leu-7-amido-4-methylcoumarin + H2O = 7-amino-4-methylcoumarin + L-Leu
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-L-Arg + H2O = L-Leu + L-Arg
-
L-Leu-L-Met + H2O = L-Leu + L-Met
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-leucine-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
LVVYPWTQRF + H2O = L-Leu + VVYPWTQRF
-
9-(L-leucylamino)-5H-benzo[a]phenoxazin-5-iminium + H2O = 9-amino-5H-benzo[a]phenoxazin-5-iminium + L-leucine
-
L-leucine 4-methylcoumaryl-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
Leu-2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu-4-methylcoumarin 7-amide + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-Ala + H2O = Leu + Ala
-
Leu-beta-naphthylamide + H2O = Leu + beta-naphthylamine
-
Leu-enkephalin + H2O = Leu + enkephalin
-
Leu-enkephalin-L-Tyr-Gly + H2O = Leu + enkephalin-L-Tyr-Gly
-
Leu-Gly + H2O = Leu + Gly
-
Leu-p-nitroanilide + H2O = Leu + p-nitroaniline
-
Leu-Leu + H2O = 2 L-Leu
-
L-Leu 4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
Leu-Ala + H2O = L-Leu + L-Ala
-
Leu-Gly + H2O = L-Leu + Gly
-
Leu-NH2 + H2O = L-Leu + NH3
-
L-Leu-4-methylumbelliferyl + H2O = L-leucine + 4-methylumbelliferol
-
L-Leu-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-Leu-7-amido-4-methyl-coumarin + H2O = L-leucine + 7-amino-4-methyl-coumarin
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucyl-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
Leu-Leu-Tyr + H2O = Leu + Leu-Tyr
-
Leu-Pro-Leu-Arg-Phe-NH2 + H2O = Leu + Pro-Leu-Arg-Phe-NH2
-
Leu-Pro-Leu-Arg-PheNH2 + H2O = Leu + Pro-Leu-Arg-PheNH2
-
L-Ala-L-Leu + H2O = L-Ala + L-Leu
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-Gly + H2O = L-Leu + Gly
-
L-Leu-L-Ala + H2O = L-Leu + L-Ala
-
L-Leu-L-Leu + H2O = L-Leu + L-Leu
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
L-Phe-L-Leu + H2O = L-Phe + L-Leu
-
L-leucine 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine-4-anisidide + H2O = L-leucine + anisidine
-
L-leucine-4-methylcoumaryl-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-anilide + H2O = L-leucine + aniline
-
LGGGGGGGGGGL + H2O = L-leucine + GGGGGGGGGGL
-
LGGGGGGGGGL + H2O = L-leucine + GGGGGGGGGL
-
LGGGL + H2O = L-leucine + GGGL
-
Leu 2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu 4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Ala-Pro-Tyr-Lys-amide + H2O = Leu + Ala-Pro-Tyr-Lys-amide
-
Leu-beta-naphthylamide + H2O = Leu + beta-naphthylamine
-
Ala-Leu + H2O = Ala + Leu
-
Asn-Leu + H2O = Asn + Leu
-
Asp-Leu + H2O = Asp + Leu
-
Cys-Leu + H2O = Cys + Leu
-
Gln-Leu + H2O = Gln + Leu
-
Glu-Leu + H2O = Glu + Leu
-
His-Leu + H2O = His + Leu
-
Ile-Leu + H2O = Ile + Leu
-
Leu-Cys + H2O = Leu + Cys
-
Leu-His + H2O = Leu + His
-
Leu-Ile + H2O = Leu + Ile
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Met + H2O = Leu + Met
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Tyr + H2O = Leu + Tyr
-
Leu-Xaa + H2O = Leu + Xaa
-
Met-Leu + H2O = Met + Leu
-
Phe-Leu + H2O = Phe + Leu
-
Ser-Leu + H2O = Ser + Leu
-
Thr-Leu + H2O = Thr + Leu
-
Trp-Leu + H2O = Trp + Leu
-
Tyr-Leu + H2O = Tyr + Leu
-
Val-Leu + H2O = Val + Leu
-
Xaa-Leu + H2O = Xaa + Leu
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-NH2 + H2O = L-Leu + NH3
-
L-Leu-O-methyl ester + H2O = L-Leu + methanol
-
4-nitrophenyl-L-leucine + H2O = 4-nitrophenol + L-leucine
-
L-Leu-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Gly-Gly + H2O = Leu + Gly-Gly
-
L-Leu-2-naphthylamide + H2O = 2-naphthylamine + L-Leu
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-enkephalin + H2O = L-Leu + enkephalin
-
L-Leu-p-nitroanilide + H2O = L-Leu + p-nitroaniline
-
LGGGGGL + H2O = L-Leu + GGGGGL
-
L-leucine-7-amido-4-methylcoumarin + H2O = L-leucine + 7-amino-4-methylcoumarin
-
L-leucine-p-nitroanilide + H2O = L-leucine + p-nitroaniline
-
Leu-4-methylcoumaryl-7-amide + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
leucyl-beta-naphthylamide + H2O = leucine + beta-naphthylamine
-
L-Leu-7-amido-4-methylcoumarin + H2O = 7-amino-4-methylcoumarin + L-Leu
-
Leu-Gly-Gly + H2O = Leu + Gly-Gly
-
Leu-Leu-Ala + H2O = Leu + Leu-Ala
-
Leu-Leu-Leu + H2O = Leu + Leu-Leu
-
L-leucyl-2-naphthylamide + H2O = L-leucine + 2-naphthylamine
-
Leu-p-nitroanilide + H2O = L-leucine + p-nitroaniline
-
Pro-Leu + H2O = Pro + Leu
-
L-Leu 7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
Arg-Leu + H2O = Arg + Leu
-
Leu-2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Gly + H2O = Leu + Gly
-
L-Leu-4-methylcoumaryl-7-amide + H2O = L-Leu + 7-amino-4-methylcoumarin
-
L-Leu-7-amido-4-methylcoumarin + H2O = L-Leu + 7-amino-4-methylcoumarin
-
Leu-7-amido-4-methylcoumarin + H2O = Leu + 7-amino-4-methylcoumarin
-
L-Leu 7-amido-4-carbamoylmethylcoumarin + H2O = L-Leu + Pro-7-amido-4-carbamoylmethylcoumarin
-
L-Leu-L-Pro-L-Pro + H2O = L-Leu + L-Pro-L-Pro
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
Leu-Ala-Pro + H2O = Leu + Ala-Pro
-
Leu-Pro + H2O = Leu + Pro
-
Leu-Pro-Gly-Gly + H2O = Leu + Pro-Gly-Gly
-
Leu-Pro-Pro + H2O = Leu + Pro-Pro
-
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
Ala-Leu + H2O = Ala + Leu
-
Leu-Ala + H2O = Leu + Ala
-
Met-Leu + H2O = Met + Leu
-
L-Leu-L-Leu + H2O = L-Leu + L-Leu
-
D-Leu-Leu + H2O = D-Leu + Leu
-
L-Leu-D-Leu + H2O = Leu + D-Leu
-
L-Leu-L-Phe + H2O = L-Leu + L-Phe
-
Ala-Leu + H2O = Ala + Leu
-
Gly-Leu + H2O = Gly + Leu
-
Leu-Arg + H2O = Leu + Arg
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Ser + H2O = Leu + Ser
-
Met-Leu + H2O = Met + Leu
-
Phe-Leu + H2O = Phe + Leu
-
Pro-Leu + H2O = Pro + Leu
-
Thr-Leu + H2O = Thr + Leu
-
L-Leu-D-Ala + H2O = L-Leu + D-Ala
-
L-Leu-D-Glu + H2O = L-Leu + D-Glu
-
L-Leu-D-Leu + H2O = L-Leu + D-Leu
-
L-Leu-D-Ser + H2O = L-Leu + D-Ser
-
L-Leu-L-Asp + H2O = L-Leu + L-Asp
-
L-Leu-L-Leu + H2O = L-Leu + L-Leu
-
L-Met-L-Leu + H2O = L-Met + L-Leu
-
Ala-Leu + H2O = Ala + Leu
-
Gly-Leu + H2O = Gly + Leu
-
Leu-Gly + H2O = Leu + Gly
-
Leu-Leu + H2O = Leu + Leu
-
Leu-Phe + H2O = Leu + Phe
-
Leu-Trp + H2O = Leu + Trp
-
Tyr-Leu + H2O = Tyr + Leu
-
beta-Ala-L-Leu + H2O = beta-Ala + L-Leu
-
Ala-Leu + H2O = Ala + Leu
-
Gly-Leu + H2O = Gly + Leu
-
Leu-Leu + H2O = Leu + Leu
-
L-Asp-L-Leu + H2O = L-Asp + L-Leu
-
L-Leu-L-Ala + H2O = L-leucine + L-alanine
-
L-Leu-L-Asn + H2O = L-leucine + L-asparagine
-
L-Trp-L-Leu + H2O = L-tryptophan + L-leucine
-
Gly-L-Leu + H2O = Gly + L-Leu
-
L-Leu-Gly + H2O = L-Leu + Gly
-
N-acetyl-L-Leu + H2O = L-Leu + acetate
-
Nalpha-chloroacetyl-L-Leu + H2O = chloroacetic acid + L-Leu
-
Nalpha-chloroacetyl-L-Leu + H2O = L-Leu + chloroacetate
-
Gly-Leu + H2O = Gly + Leu
-
Leu-Gly + H2O = Leu + Gly
-
Nalpha-chloro-acetyl-L-Leu + H2O = chloroacetate + Leu
-
L-Leu-L-Pro + H2O = L-Leu + L-Pro
-
L-Pro-L-Leu + H2O = L-Pro + L-Leu
-
Leu-Pro + H2O = Leu + Pro
-
His-Pro-Leu + H2O = His-Pro + Leu
-
Val-Pro-Leu + H2O = Val-Pro + Leu
-
N-benzyloxycarbonyl-L-Pro-Leu + H2O = N-benzyloxycarbonyl-L-Pro + L-Leu
-
4-phenylazobenzyloxycarbonyl-Pro-Leu + H2O = 4-phenylazobenzyloxycarbonyl-Pro + Leu
-
N-benzyloxycarbonyl-Pro-Leu + H2O = N-benzyloxycarbonyl-Pro + Leu
-
benzyloxycarbonyl-L-Phe-L-Leu + H2O = benzyloxycarbonyl-L-Phe + L-Leu
-
FVNQHLCGSHLVEAL + H2O = FVNQHLCGSHLVE + L-Ala-L-Leu + L-Leu
-
CBZ-Phe-Leu + H2O = N-benzyloxycarbonyl-L-Phe + L-leucine
-
acetyl-Phe-Leu + H2O = acetyl-Phe + Leu
-
Benzyloxycarbonyl-Ala-Leu + H2O = Benzyloxycarbonyl-Ala + Leu
-
benzyloxycarbonyl-Glu-Leu + H2O = benzyloxycarbonyl-Glu + Leu
-
Benzyloxycarbonyl-Gly-Leu + H2O = Benzyloxycarbonyl-Gly + Leu
-
benzyloxycarbonyl-His-Leu + H2O = benzyloxycarbonyl-His + Leu
-
benzyloxycarbonyl-Ile-Leu + H2O = benzyloxycarbonyl-Ile + Leu
-
benzyloxycarbonyl-L-phenylalanyl-L-leucine + H2O = benzyloxycarbonyl-Phe + Leu
-
benzyloxycarbonyl-Leu-Leu + H2O = benzyloxycarbonyl-Leu + Leu
-
benzyloxycarbonyl-Nle-Leu + H2O = benzyloxycarbonyl-Nle + Leu
-
benzyloxycarbonyl-Phe-Leu + H2O = benzyloxycarbonyl-Phe + Leu
-
benzyloxycarbonyl-Phe-Tyr-Leu + H2O = benzyloxycarbonyl-Phe-Tyr + Leu
-
benzyloxycarbonyl-Pro-Leu + H2O = benzyloxycarbonyl-Pro + Leu
-
benzyloxycarbonyl-Ser-Leu + H2O = benzyloxycarbonyl-Ser + Leu
-
benzyloxycarbonyl-Val-Leu + H2O = benzyloxycarbonyl-Val + Leu
-
furylacryloyl-Ala-Leu + H2O = furylacryloyl-Ala + Leu
-
furylacryloyl-Arg-Leu + H2O = furylacryloyl-Arg + Leu
-
furylacryloyl-Lys-Leu + H2O = furylacryloyl-Lys + leu
-
furylacryloyl-Phe-Leu + H2O = furylacryloyl-Phe + Leu
-
Leu-4-nitroanilide + H2O = Leu + 4-nitroaniline
-
benzyloxycarbonyl-Phe-Leu + H2O = benzyloxycarbonyl-Phe + L-leucine
-
benzyloxycarbonyl-Phe-Tyr-Leu + H2O = benzyloxycarbonyl-Phe-Tyr + L-leucine
-
benzyloxycarbonyl-Tyr-Leu + H2O = benzyloxycarbonyl-Tyr + L-leucine
-
3-(2-furyl)acryloyl-L-Phe-L-Leu + H2O = 3-(2-furyl)acryloyl-L-Phe + L-Leu
-
carbobenzoxy-Gly-L-Leu + H2O = carbobenzoxy-Gly + L-Leu
-
N-carbobenzoxy-Gly-Gly-L-Leu + H2O = N-carbobenzoxy-Gly-Gly + L-Leu
-
angiotensin I + H2O = Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His + Leu
-
angiotensin I + H2O = des-Leu10 angiotensin I + Leu
-
benzyloxycarbonyl-Phe-Leu + H2O = benzyloxycarbonyl-Phe + Leu
-
carbobenzoxy-Gly-Gly-Leu + H2O = carbobenzoxy-Gly-Gly + Leu
-
benzyloxycarbonyl-Ala-Ala-Leu + H2O = benzyloxycarbonyl-Ala-Ala + L-Leu
-
N-benzyloxycarbonyl-Ala-Ala-Leu + H2O = N-benzyloxycarbonyl-Ala-Ala + L-leucine
-
benzyloxycarbonyl-alanyl-alanyl-leucine + H2O = benzyloxycarbonyl-Ala-Ala + Leu
-
N-carbobenzoxy-Ala-Ala-Leu + H2O = N-carbobenzoxy-Ala-Ala + Leu
-
Carbobenzoxy-Gly-Leu + H2O = Carbobenzoxy-Gly + Leu
-
angiotensin I + H2O = DRVYIHPFH + L-Leu
-
angiotensin I + H2O = angiotensin-(1-9) + Leu
-
hippuryl-L-His-L-Leu + H2O = hippuryl-L-His + L-Leu
-
hippuryl-L-Lys-L-Leu + H2O = hippuryl-L-Lys + L-Leu
-
Benzyloxycarbonyl-Gly-Leu + H2O = Benzyloxycarbonyl-Gly + Leu
-
benzyloxycarbonyl-Phe-Leu + H2O = benzyloxycarbonyl-Phe + Leu
-
dibenzyloxycarbonyl-Lys-Leu + H2O = dibenzyloxycarbonyl-Lys + Leu
-
Leu-Ala + H2O = Leu + Ala
-
L-Bz-Leu + H2O = benzoic acid + L-leucine
-
L-Fur-Leu + H2O = furoic acid + L-leucine
-
benzyloxycarbonyl-Phe-Leu + H2O = benzyloxycarbonyl-Phe + Leu
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His + L-leucine
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + L-leucine
-
N-benzyloxycarbonyl-Ala-Leu + H2O = N-benzyloxycarbonyl-Ala + L-leucine
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His + L-leucine
-
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + L-leucine
-
N-carboxybenzoyl-Ala-Leu + H2O = N-carboxybenzoyl-Ala + L-leucine
-
2-aminobenzoyl-Phe-Arg-Leu + H2O = 2-aminobenzoyl-Phe-Arg + Leu
-
acetyl-Gly-Leu + H2O = acetyl-Gly + Leu
-
formylmethionine-Leu + H2O = formylmethionine + Leu
-
Leu-beta-naphthylamide + H2O = Leu + 2-naphthylamine
-
N-acetyl-Ala-Leu + H2O = N-acetyl-Ala + Leu
-
Tyr-Leu + H2O = Tyr + Leu
-
gamma-glutamyl L-leucine + H2O = L-leucine + L-glutamate
-
pyroglutamyl-Leu + H2O = pyroglutamate + Leu
-
alpha-Asp-Leu + H2O = L-Asp + L-Leu
-
beta-L-Asp-L-Leu + H2O = L-Asp + L-Leu
-
alpha-Asp-Leu + H2O = Asp + Leu
-
beta-Asp-Leu + H2O = Asp + Leu
-
N-Formyl-Met-Leu + H2O = N-Formyl-Met + Leu
-
L-leucyl-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
L-Leu-4-nitroanilide + H2O = L-Leu + 4-nitroaniline
-
benzyloxycarbonyl-Gly-Pro-Leu + H2O = benzyloxycarbonyl-Gly-Pro + Leu
-
Succinyl-Leu-Leu-Val-Tyr 4-methylcoumarin 7-amide + H2O = Succinyl-Leu + Leu + Val-Tyr 4-methylcoumarin 7-amide
-
N-benzyloxycarbonyl-Gly-Pro-Leu + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Leu
-
L-Leu-2-naphthylamide + H2O = L-Leu + 2-naphthylamine
-
L-Leu-beta-naphthylamide + H2O = L-Leu + beta-naphthylamine
-
L-leucyl-2-naphthylamide + H2O = L-leucine + 2-naphthylamine
-
Leu-2-naphthylamide + H2O = Leu + 2-naphthylamine
-
Leu-4-methylcoumaryl-7-amide + H2O = Leu + 7-amino-4-methylcoumarin
-
Leu-2-naphthylamide + H2O = leucine + 2-naphthylamine
-
Benzyloxycarbonyl-Ala-Leu + H2O = Benzyloxycarbonyl-Ala + Leu
-
Benzyloxycarbonyl-Gly-Leu + H2O = Benzyloxycarbonyl-Gly + Leu
-
Gly-Leu + H2O = Gly + Leu
-
Leu-p-nitroanilide + H2O = Leu + 4-nitroaniline
-
L-Leu amide + H2O = Leu + NH3
-
L-Leu-L-Tyr + H2O = Leu + Tyr
-
Z-Gly-Pro-Leu-Gly-Pro + H2O = Z-Gly-Pro + L-Leu + Gly + L-Pro
-
Z-Gly-Pro-Leu-Gly-Pro + H2O = Z-Gly-Pro + L-Leu + Gly + L-Pro
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHLCGSH + LVEA + Leu + Tyr + LVCGERGF + FYTPKA
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHLCGSHL + VEA + Leu + Tyr + LVCGERGF + Phe + YTPKA
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
-
PMVELAGE + H2O = PMVE + L-Leu + AGE
-
PMVELQGE + H2O = PMVE + L-Leu + QGE
-
PMVELTGE + 2 H2O = PMVE + L-Leu + TGE
-
PMVELWGE + H2O = PMVE + L-Leu + WGE
-
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
-
Gly-Phe-Leu + H2O = Phe-Leu + Gly-Phe + Gly + Leu
-
GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O = Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + Tyr + Leu + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2
-
Ala-Leu + H2O = Alanine + leucine
-
Gly-Leu + H2O = Glycine + leucine
-
His-Leu + H2O = Histidine + leucine
-
Leu-Gly + H2O = Leucine + glycine
-
Leu-Tyr + H2O = Leucine + tyrosine
-
Tyr-Leu + H2O = Tyrosine + leucine
-
L-leucine amide + H2O = L-leucine + NH3
-
N-phenylacetyl-Leu + H2O = phenylacetic acid + Leu
-
N-phenylacetyl-alpha-leucine + H2O = leucine + phenylacetate
-
jasmonoyl-L-leucine + H2O = jasmonic acid + L-leucine
-
L-Leu beta-naphthylamide + H2O = Leu + beta-naphthylamine
-
L-Leu p-nitroanilide + H2O = Leu + p-nitroaniline
-
L-Leu-beta-naphthylamide + H2O = Leu + beta-naphthylamine
-
L-Leu-L-Ala + H2O = Leu + Ala
-
L-Leu-L-Phe + H2O = Leu + Phe
-
L-Leu-L-Tyr + H2O = Leu + Tyr
-
L-Leu-L-Val + H2O = Leu + Val
-
Leu-NH2 + H2O = Leu + NH3
-
N-acetyl-L-Leu + H2O = acetate + L-Leu
-
benzoyl-L-leucine + H2O = benzoate + L-leucine
-
chloroacetyl-L-leucine + H2O = chloroacetate + L-leucine
-
N-acetyl-L-leucine + H2O = acetate + L-leucine
-
N-alpha-acetyl-L-leucine + H2O = acetate + L-leucine
-
N-benzoyl-L-leucine + H2O = benzoate + L-leucine
-
N-chloroacetyl-L-leucine + H2O = chloroacetate + L-leucine
-
N-lauroyl-L-leucine + H2O = laurate + L-leucine
-
chloroacetyl-L-leucine + H2O = chloroacetate + L-leucine
-
acetyl-L-leucine + H2O = acetate + leucine
-
N-acetylleucine + H2O = acetate + leucine
-
Nalpha-acetyl-L-leucine + H2O = L-leucine + acetate
-
L-leucine amide + H2O = L-Leu + NH3
-
N-formyl-leucine + H2O = formate + leucine
-
glycyl-L-leucine + H2O = glycine + L-leucine
-
L-leucinamide + H2O = L-leucine + NH3
-
L-leucineamide + H2O = L-leucine + NH3
-
L-leucinamide + H2O = L-leucine + NH3
-
Nalpha-acetyl-L-Leu + H2O = methanol + CO2 + L-Leu
-
Nalpha-benzoyl-L-Leu + H2O = phenol + CO2 + L-Leu
-
Nalpha-benzyloxycarbonyl-Leu + H2O = benzyl alcohol + CO2 + L-Leu
-
Nalpha-tert-butoxycarbonyl-L-Leu + H2O = tert-butanol + CO2 + L-Leu
-
N-carbamoyl-L-leucine + H2O = L-leucine + CO2 + NH3
-
N-formyl-DL-leucine + H2O = L-leucine + CO2
-
DL-alpha-aminoisocapronitrile + H2O = L-leucine + NH3
-
5-L-glutamyl-L-leucine = 5-oxoproline + L-leucine
-
AMP + diphosphate + L-leucyl-Pyrococcus horikoshii tRNALeu(GAG) = ATP + L-leucine + Pyrococcus horikoshii tRNALeu(GAG)
-
ATP + H2O + L-Leu/out = ADP + phosphate + L-Leu/in
-
ATP + H2O + L-leucine/out = ADP + phosphate + L-leucine/in
-
ATP + H2O + L-leucine/out = ADP + phosphate + L-leucine/in
-
ATP + H2O + L-leucine-[L-leucine-binding protein][side 1] = ADP + phosphate + L-leucine[side 2] + [L-leucine-binding protein][side 1]
-
ATP + H2O + leucine/out = ADP + phosphate + leucine/in
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
0.014
-
isozymes beta1 and beta2
0.21
-
mutant enzyme F124M/V125S/H126I/A127I/A128Y/R129Q
0.74
-
mutant enzyme A113A/V291L
2.8
-
mutant enzyme A113A
10.83
-
in 100 mM glycine-KCl-KOH buffer (pH 10), at 25°C
0.13
-
at pH 8.5 and 30°C
1.8
-
pH and temperature not specified in the publication
1.8
-
in 50 mM Tris-HCl buffer pH 8.0, at 37°C
2.32
-
untreated recombinant protein, pH 7, 30°C
3.3
-
pH and temperature not specified in the publication
24.4
-
at pH 7.8 and 50°C
45.3
-
acid-activited recombinant protein, pH 7, 30°C
47.98
-
pH and temperature not specified in the publication
48.22
-
pH and temperature not specified in the publication
52
-
pH and temperature not specified in the publication
75.16
-
pH and temperature not specified in the publication
96.2
-
pH and temperature not specified in the publication
1025.05
-
pH and temperature not specified in the publication
5965
-
pH not specified in the publication, temperature not specified in the publication
0.009
-
mutant enzyme R23A, in 50 mM HEPES-NaOH buffer, pH 8.0, 50 mM KCl, 0.15 mM pyridoxal 5'-phosphate, at 45°C
0.023
-
mutant enzyme S20E, in 50 mM HEPES-NaOH buffer, pH 8.0, 50 mM KCl, 0.15 mM pyridoxal 5'-phosphate, at 45°C
0.05
-
mutant enzyme R23Q, in 50 mM HEPES-NaOH buffer, pH 8.0, 50 mM KCl, 0.15 mM pyridoxal 5'-phosphate, at 45°C
5.1
-
wild type enzyme, in 50 mM HEPES-NaOH buffer, pH 8.0, 50 mM KCl, 0.15 mM pyridoxal 5'-phosphate, at 45°C
8.1
-
pH not specified in the publication, 25°C
8.1
-
SlBCAT2, pH not specified in the publication, 25°C
15.7
-
SlBCAT6, pH not specified in the publication, 25°C
17.9
-
SlBCAT4, pH not specified in the publication, 25°C
39.1
-
SlBCAT1, pH not specified in the publication, 25°C
40.8
-
pH not specified in the publication, 25°C
60.8
-
mutant enzyme C315A/C318A
80.2
-
SpBCAT1, pH not specified in the publication, 25°C
110
-
half transamination reaction, pH 8.0, 90°C
118
-
SlBCAT5, pH not specified in the publication, 25°C
121
-
SlBCAT3, pH not specified in the publication, 25°C
213
-
mutant enzyme C335S/C338S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
253
-
mutant enzyme C335S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
286
-
mutant enzyme C221S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
310
-
mutant enzyme C318A
430
-
mutant enzyme C338S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
651
-
mutant enzyme C242S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
756
-
mutant enzyme C235S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
803
-
mutant enzyme C293S, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
898
-
wild type enzyme, in 25 mM potassium phosphate buffer at pH 7.8, at 37°C
0.00961
-
isoform LeuRS2, in 20 mM Tris-HCl, pH 9.0, 3.5 M KCl, 30 mM MgCl2, 1 mM dithiohtreitol, at 40°C
0.134
-
recombinant enzyme complex, 65°C
0.18
-
recombinant mitochondrial isozyme mutant, 37°C
0.23
-
recombinant mitochondrial isozyme mutant, 37°C
0.3
-
37°C, pH 7.6, leucylation, full-length enzyme
0.39
-
aminoacylation reaction, pH 7.8, 37°C
0.56
-
37°C, pH 7.6, leucylation, DELTAChcLeuRS (a C-terminal 89-amino acid truncated enzyme form)
0.563
-
isoform LeuRS1, in 20 mM Tris-HCl, pH 9.0, 3.5 M KCl, 30 mM MgCl2, 1 mM dithiohtreitol, at 40°C
0.8
-
mutant E292K, pH 7.8, 37°C
0.8
-
mutant enzyme T252A, aminoacylation
0.81
-
37°C, pH 7.6, ATP-diphosphate exchange, DELTAChcLeuRS (a C-terminal 89-amino acid truncated enzyme form)
0.82
-
37°C, pH 7.6, ATP-diphosphate exchange, full-length enzyme
1
-
mutant Y515E, pH 8.2, 45°C
1.1
-
mutant Y520H, pH 8.2, 45°C
1.4
-
aminoacylation reaction, pH 7.8, 60°C
1.4
-
mutant Y520E, pH 8.2, 45°C
1.4
-
pH 6.8, 65°C, recombinant wild-type enzyme
1.5
-
mutant enzyme, pH 7.8, 37°C
1.57
-
65°C, wild-type enzyme
1.6
-
mutant E292S, pH 7.8, 37°C
1.79
-
65°C, recombinant His6-tagged enzyme
1.8
-
mutant E292F, pH 7.8, 37°C
1.8
-
mutant Y515K, pH 8.2, 45°C
1.8
-
mutant Y520A, pH 8.2, 45°C
1.9
-
mutant E292A, pH 7.8, 37°C
2.1
-
wild-type, pH 7.6, 30°C
2.2
-
mutant E292Q, pH 7.8, 37°C
2.4
-
mutant E292D, pH 7.8, 37°C
2.6
-
mutant Y515A, pH 8.2, 45°C
2.7
-
recombinant mitochondrial isozyme, pH 7.6, 37°C
2.7
-
wild-type, pH 8.2, 45°C
2.8
-
mutant lacking residues Q281 to D294, 45°C
2.8
-
mutant lacking residues S295 to L304, 45°C
3
-
wild-type enzyme, pH 7.8, 37°C
3.1
-
pH 7.5, 65°C, mutant E114A
3.1
-
pH 7.5, 65°C, mutant K100A/Y105A
3.2
-
pH 7.5, 65°C, mutant D98A
3.4
-
pH 7.5, 65°C, mutant F119A
3.5
-
ATP-diphosphate exchange reaction, pH 7.8, 37°C
3.8
-
pH 7.5, 65°C, mutant T101A
3.9
-
pH 7.5, 65°C, mutant K100A
4.1
-
pH 7.5, 65°C, mutant V108A
4.3
-
pH 7.5, 65°C, mutant Y105A
4.4
-
pH 7.5, 65°C, mutant N96A
4.6
-
37°C, pH 7.8, mutant enzyme T25D
4.6
-
pH 7.5, 65°C, mutant K100A/Y109A
4.7
-
pH 7.5, 65°C, mutant R106A
4.7
-
pH 7.5, 65°C, mutant Y109A
4.9
-
37°C, pH 7.8, mutant enzyme T252E
5.1
-
37°C, pH 7.8, native enzyme
5.1
-
mutant enzyme T252S, aminoacylation
5.1
-
pH 7.5, 65°C, mutant R97A
5.1
-
pH 7.5, 65°C, mutant W103A
5.1
-
wild-type enzyme, pH 7.8, 37°C
5.2
-
pH 7.5, 65°C, mutant E113A
5.2
-
wild-type enzyme, pH 7.8, 37°C
5.6
-
mutant D399A, pH 7.6, 30°C
5.6
-
pH 7.5, 65°C, mutant I104A
5.9
-
pH 8.2, 45°C, mutant Q154A
6
-
pH 7.5, 65°C, mutant D121A
6
-
pH 7.5, 65°C, wild-type enzyme
6.1
-
wild-type enzyme, aminoacylation
6.2
-
mutant enzyme T252V, aminoacylation
6.2
-
pH 8.2, 45°C, mutant K152A
8.1
-
pH 7.5, 65°C, mutant T118A
10.7
-
pH 7.5, 65°C, mutant I115A
15.5
-
ATP-diphosphate exchange reaction, pH 7.8, 60°C
20
50
ATP-diphosphate exchange reaction
25.8
-
pH 7.6, 37°C, wild-type enzyme
26.2
-
pH 7.6, 37°C, mutant D399A
28.1
-
pH 8.2, 45°C, mutant K170A
28.4
-
pH 8.2, 45°C, mutant K148A
28.7
-
pH 8.2, 45°C, mutant K166A
28.9
-
pH 8.2, 45°C, mutant K144A
29.7
-
pH 8.2, 45°C, mutant E165A
29.9
-
pH 8.2, 45°C, mutant K139A
31.7
-
pH 8.2, 45°C, mutant K142A
31.9
-
pH 8.2, 45°C, mutant W155A
32.5
-
pH 8.2, 45°C, mutant S153A
33.1
-
pH 8.2, 45°C, mutant K141A
36.3
-
pH 8.2, 45°C, mutant D173A
54.6
-
pH 8.2, 45°C, mutant E167A
73.7
-
wild type enzyme, in 100 mM HEPES (pH 7.8), 10 mM MgCl2, at 37°C
101
-
ATP-diphosphate exchange reaction, mutant enzyme, pH 7.8, 37°C
171
-
ATP-diphosphate exchange reaction, wild-type enzyme, pH 7.8, 37°C
0.03
-
pH 7.5, 25°C, the assay measures the release of diphosphate by means of a coupled enzyme system in which diphosphate drives the reduction of NAD+ to NADH
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
more
Show all BRENDA pathways known for L-leucine
close all tables 
open all tables
top
