Ligand L-leucine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-leucine (click for magnification)
Molecular Formula
(2S)-2-amino-4-methylpentanoic acid, (2S)-alpha-leucine, alpha-Leu, L-4-methyl-norvaline, L-Leu, L-leucine[side 2], Leu, leucine

Show all pahtways known for Show all BRENDA pathways known for L-leucine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (22 results)

L-leucine + O2 = ? + H2O2
show the reaction diagram
acetyl-CoA + L-leucine = CoA + N-acetyl-L-leucine
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
alpha-Leu = ?
show the reaction diagram
ATP + L-leucine + an L-amino acid = ADP + phosphate + L-leucyl-L-amino acid
show the reaction diagram
ATP + (2E)-4-[[(2S)-2-amino-2-carboxyethyl]amino]-4-oxobut-2-enoate + L-leucine = ADP + phosphate + N-[(2S)-3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-2-methylpropanoyl]-L-leucine
show the reaction diagram

In Vivo Product in Enzyme-catalyzed Reactions (37 results)

Leu-enkephalin + H2O = Leu + enkephalin
show the reaction diagram
Z-Gly-Pro-Leu-Gly-Pro + H2O = Z-Gly-Pro + L-Leu + Gly + L-Pro
show the reaction diagram
D-Leu = L-Leu
show the reaction diagram

Substrate in Enzyme-catalyzed Reactions (191 results)

L-leucine + H2O + NAD+ = 4-methyl-2-oxopentanoate + NH3 + NADH
show the reaction diagram
L-leucine + H2O + NAD+ = ? + NH3 + NADH
show the reaction diagram
L-leucine + H2O + NAD+ = 2-oxoisocaproate + NADH + NH3
show the reaction diagram
L-leucine + O2 + H2O = 4-methyl-2-oxopentanoate + NH3 + H2O2
show the reaction diagram
L-leucine + H2O + 2 cytochrome b = 2-oxo-4-methylpentanoate + NH3 + 2 reduced cytochrome b
show the reaction diagram
L-Leu + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Leu + NAD+
show the reaction diagram
L-leucine + 2,6-dichlorophenolindophenol + H2O = ? + reduced 2,6-dichlorophenolindophenol
show the reaction diagram
pyruvate + L-leucine = alanine + 4-methyl-2-oxopentanoate
show the reaction diagram
2-oxosuccinamic acid + L-leucine = L-asparagine + 4-methyl-2-oxopentanoate
show the reaction diagram
L-leucine + 2-oxoglutarate = 2-oxo-4-methylpentanoate + L-glutamate
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
L-leucine + glyoxylate = 4-methyl-2-oxopentanoate + glycine
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoic acid + L-glutamate
show the reaction diagram
L-leucine + glyoxylate = 4-methyl-2-oxopentanoate + glycine
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
L-leucine + pyruvate = 4-methyl-2-oxopentanoate + L-alanine
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
L-leucine + indole-3-pyruvic acid = 2-oxo-4-methylpentanoate + L-tryptophan
show the reaction diagram
L-leucine + 2-oxoglutarate = 4-methyl-2-oxopentanoate + L-glutamate
show the reaction diagram
benzyloxycarbonyl-Glu-methyl ester + leucine = benzyloxycarbonyl-Glu-Leu + methanol
show the reaction diagram
L-Leu = 3-Methylbutylamine + CO2
show the reaction diagram
L-Leu = 3-Methylbutylamine + CO2
show the reaction diagram
2-Oxobutanoate + L-Leu = ?
show the reaction diagram
L-Leu = 3-Hydroxy-2-oxopropionate + NH3
show the reaction diagram
L-leucine + alpha-ketoglutarate = ?
show the reaction diagram
L-leucine = D-leucine
show the reaction diagram
L-leucine = D-leucine
show the reaction diagram
ATP + L-leucine + tRNAPhe = AMP + diphosphate + L-leucyl-tRNAPhe
show the reaction diagram
ATP + L-leucine + tRNALys = AMP + L-leucyl-tRNALys + diphosphate
show the reaction diagram
ATP + L-leucine + [CmaA-protein-T-domain]-4'-phosphopantetheine = AMP + diphosphate + S-L-leucyl-[CmaA-protein-T-domain]-4'-phosphopantetheine
show the reaction diagram
ATP + L-Glu + L-leucine = ADP + phosphate + gamma-L-Glu-L-leucine
show the reaction diagram
ATP + 3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-L-alanine + L-leucine = ADP + phosphate + 3-(((2E)-4-amino-4-oxobut-2-enoyl)amino)-L-alanyl-L-leucine
show the reaction diagram
ATP + (-)-jasmonate + L-Leu = AMP + diphosphate + jasmonoyl-L-Leu
show the reaction diagram
ATP + (2E)-4-[[(2S)-2-amino-2-carboxyethyl]amino]-4-oxobut-2-enoate + L-leucine = ADP + phosphate + N-[(2S)-3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-2-methylpropanoyl]-L-leucine
show the reaction diagram
2 ATP + 2 L-Val + L-Leu = 2 ADP + 2 phosphate + L-Val-L-Val-L-Leu
show the reaction diagram

Product in Enzyme-catalyzed Reactions (573 results)

2-oxo-iso-valerate + NADPH + NH3 = L-leucine + NADP+ + H2O
show the reaction diagram
2-oxoisohexanoate + NH3 + NADH + H+ = L-leucine + H2O + NAD+
show the reaction diagram
N-methyl-L-leucine + O2 + H2O = formaldehyde + L-leucine + H2O2
show the reaction diagram
N-methyl-L-leucine + acceptor + H2O = L-leucine + formaldehyde + reduced acceptor
show the reaction diagram
5-L-glutamyl-L-leucine + glycylglycine = L-Leu + 5-L-glutamyl-glycylglycine
show the reaction diagram
L-aspartate + 2-oxoisocaproate = oxaloacetate + L-leucine
show the reaction diagram
L-alanine + 2-oxoisohexanoate = pyruvate + L-leucine
show the reaction diagram
2-oxoisocaproate + L-glutamate = L-leucine + 2-oxoglutarate
show the reaction diagram
L-leucine + 4-methyl-2-oxopentanoate = 4-methyl-2-oxopentanoate + L-leucine
show the reaction diagram
L-methionine + 2-oxo-isocaproate = 2-oxo-4-methylthiobutanoate + L-leucine
show the reaction diagram
(R)-alpha-methylbenzylamine + 4-methyl-2-oxovalerate = acetophenone + L-leucine
show the reaction diagram
Leu-tRNA + H2O = Leu + tRNA
show the reaction diagram
[leu5] enkephalin + H2O = Tyr + Leu
show the reaction diagram
L-leucine-4-methylcoumarin-7-amide + H2O = L-leucine + 7-amino-4-methylcoumarin
show the reaction diagram
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
L-leucyl 4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
L-Asp-L-Leu + H2O = L-Asp + L-Leu
show the reaction diagram
N-hippuryl-His-Leu + H2O = hippuric acid + His + Leu
show the reaction diagram
Carbobenzoxy-Gly-Leu + H2O = Carbobenzoxy-Gly + Leu
show the reaction diagram
Leu-Ala + H2O = Leu + Ala
show the reaction diagram
2-aminobenzoyl-Phe-Arg-Leu + H2O = 2-aminobenzoyl-Phe-Arg + Leu
show the reaction diagram
gamma-glutamyl L-leucine + H2O = L-leucine + L-glutamate
show the reaction diagram
pyroglutamyl-Leu + H2O = pyroglutamate + Leu
show the reaction diagram
N-Formyl-Met-Leu + H2O = N-Formyl-Met + Leu
show the reaction diagram
L-leucyl-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
Succinyl-Leu-Leu-Val-Tyr 4-methylcoumarin 7-amide + H2O = Succinyl-Leu + Leu + Val-Tyr 4-methylcoumarin 7-amide
show the reaction diagram
N-benzyloxycarbonyl-Gly-Pro-Leu + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Leu
show the reaction diagram
Z-Gly-Pro-Leu-Gly-Pro + H2O = Z-Gly-Pro + L-Leu + Gly + L-Pro
show the reaction diagram
Z-Gly-Pro-Leu-Gly-Pro + H2O = Z-Gly-Pro + L-Leu + Gly + L-Pro
show the reaction diagram
show the reaction diagram
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
L-leucine-4-nitroanilide + H2O = L-leucine + 4-nitroaniline
show the reaction diagram
Gly-Phe-Leu + H2O = Phe-Leu + Gly-Phe + Gly + Leu
show the reaction diagram
show the reaction diagram
L-leucine amide + H2O = L-leucine + NH3
show the reaction diagram
jasmonoyl-L-leucine + H2O = jasmonic acid + L-leucine
show the reaction diagram
Nalpha-acetyl-L-leucine + H2O = L-leucine + acetate
show the reaction diagram
L-leucine amide + H2O = L-Leu + NH3
show the reaction diagram
N-formyl-leucine + H2O = formate + leucine
show the reaction diagram
glycyl-L-leucine + H2O = glycine + L-leucine
show the reaction diagram
L-leucinamide + H2O = L-leucine + NH3
show the reaction diagram
DL-alpha-aminoisocapronitrile + H2O = L-leucine + NH3
show the reaction diagram
5-L-glutamyl-L-leucine = 5-oxoproline + L-leucine
show the reaction diagram
D-leucine = L-leucine
show the reaction diagram
AMP + diphosphate + L-leucyl-Pyrococcus horikoshii tRNALeu(GAG) = ATP + L-leucine + Pyrococcus horikoshii tRNALeu(GAG)
show the reaction diagram

Activator in Enzyme-catalyzed Reactions (27 results)

2.2fold activation at 50 mM
1% L-leucine stimulates activity
5 mM, 1.69fold activation
4fold activation at 2.5 mM
5 mM, activation of alkaline phosphatase grown in high phosphate medium to 155% of the control value
inhibitory to enzyme isoform prolidase I, activating isoform prolidase II
activates enzyme from mesenteric lymph nodes, 50% activation at 0.6 mM
1 mM, relative activity 120%
excess leucine intake strongly induces SDH activity in the liver but not in the kidney

Inhibitor in Enzyme-catalyzed Reactions (131 results)

29% inhibition at 1 mM
54% inhibition at 5 mM leucine in the growth medium
inhibits, when added to a final concentration of 10 mM in the assay system produces a decrease of 0.004 units in specific activity
10 mM, 52% inhibition
inhibition 50% by 10 mM L-leucine
competitive inhibition of the reductive amination of 4-methylthio-2-oxobutanoate
6% inhibition at 6.67 mM
pH 7.6, 30°C
D-alanine oxidation
inhibits only the mutants Y454A and V468A
50% inhibition
2 mM, 20% inhibition
with 1 mM tyrosine as the substrate, 10 mM leucine inhibits activity by 93%
in presence of L-norleucine: ping-pong bi-bi inhibition with alternative substrates
10 mM, 20% inhibition
allosteric effector
branched chain alpha-amino acids bind at the active site, competitive inhibition mechanism against substrates phosphocreatine and ADP, inhibition kinetics
competitive inhibition
inhibitory to enzyme isoform prolidase I, activating isoform prolidase II
partial inhibition, 8 mM: 89% of activity compared to H2O
84% residual activity at 5 mM with L-methionine as substrate, 94% residual activity at 50 mM with D-methionine as substrate

Metals and Ions (1 result)

about 550% activity at 1 mM

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (165 results)

isozymes beta1 and beta2
at pH 7.0 and 34°C
pH 10.0, 21°C
pH 8.0, 25°C
pH 7.5, 25°C, the assay measures the release of diphosphate by means of a coupled enzyme system in which diphosphate drives the reduction of NAD+ to NADH
pH 8.0, 22°C

KM Value (254 results)

at pH 7.0 and 34°C
cosubstrate 2-oxosuccinamate
with phenylpyruvate, pH 8.0, 30°C
pH 8.0, 25°C
in the presence of 2-oxoglutarate
apparent Km value, at pH 7.4, 37°C