Any feedback?
Ligand L-glutamine
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Basic Ligand Information
(2S)-2,5-diamino-5-oxopentanoic acid, D-(or L-)glutamine, Gln, glutamine, L-Gln, L-glutamine[side 2]
BRENDA
moreKEGG
Show all BRENDA pathways known for L-glutamine
close all tables 
open all tablesRoles as Enzyme Ligand
In Vivo Substrate in Enzyme-catalyzed Reactions (81 results)
top
EC NUMBER 
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-glutamine + 2-oxoglutarate + NADH + H+ = L-glutamate + NAD+
-
L-glutamine + 2-oxoglutarate + NADH = glutamate + NAD+
391495, 391485, 391491, 391492, 391490, 391494, 391476, 391474, 391473, 392019, 391489, 391480, 391481, 391479, 391470, 391471, 391472, 391483
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin + H+ = L-glutamate + oxidized ferredoxin
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin + NADPH + H+ = L-glutamate + oxidized ferredoxin + NADP+
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin = L-glutamate + oxidized ferredoxin
392022, 392001, 392004, 392019, 392026, 392002, 392006, 392013, 392020, 392021, 392017, 392007, 392008, 392014, 392012, 392003, 392005, 391450, 392018, 392028, 392030, 723865, 392016, 392009, 392010, 392011
-
4-hydrazinobenzoic acid + L-glutamine = beta-N-(gamma-L-glutamyl)-4-carboxyphenylhydrazine
-
L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O = 5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate
-
L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O = L-glutamate + 5-phospho-beta-D-ribosylamine + diphosphate
-
L-glutamine + 2-deoxy-scyllo-inosose = 2-oxoglutaramate + 2-deoxy-scyllo-inosamine
-
L-glutamine + 3-amino-2,3-dideoxy-scyllo-inosose = 2-oxoglutaramate + 2-deoxystreptamine
-
L-glutamine + 4-(methylsulfanyl)-2-oxobutanoate = 2-oxoglutaramate + L-methionine
-
chorismate + 2 L-glutamine + H2O = 4-amino-4-deoxychorismate + 2 L-glutamate + ammonia
-
L-glutamine + D-fructose 6-phosphate = L-glutamate + D-glucosamine 6-phosphate
-
2-deoxy-scyllo-inosose + L-glutamine = 2-deoxy-scyllo-inosamine + 2-ketoglutaramate
-
L-glutamine + 2,4,6/3,5-pentahydroxycyclohexanone = 2-oxoglutaramate + 1-amino-1-deoxy-scyllo-inositol
-
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
-
chorismate + L-glutamine = 4-amino-4-deoxychorismate + L-glutamate
-
L-glutamine + 7-cyano-7-carbaguanine15 in tRNA + H2O = L-glutamate + archaeine15 in tRNA
-
ATP + L-glutamine + H2O = AMP + phosphate + N5-phospho-L-glutamine
-
L-glutamine + H2O = L-glutamate + NH3
668317, 733460, 733262, 734673, 667496, 718889, 720942, 734818, 735073, 667477, 663903, 733133, 667444, 668534, 718613, 733562, 669542, 733187, 668902, 733233, 718925, 669739, 655373, 666994, 670768, 734440, 735259, 719981, 720975, 733239, 656222, 654884, 655601, 654234, 656204, 657262, 655542, 669592, 670129, 669694, 669950, 670391, 689587
-
L-glutamine + H2O = L-glutamate + NH3
209091, 209093, 209100, 670274, 209097, 209095, 209089, 209090, 209092, 209098, 209101, 209099, 209103, 209094, 687356
-
chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
746743, 747843, 728052, 747926, 747400, 747427, 747430, 748637, 748650, 694016, 691420, 692505, 694976, 746626, 749037, 747617
-
L-glutamine + N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate = L-glutamate + D-erythro-1-(imidazol-4-yl)glycerol phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate + L-glutamine = L-glutamate + D-erythro-1-(imidazol-4-yl)glycerol phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide + L-glutamine = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide + D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate + L-glutamate
-
D-ribose 5-phosphate + D-glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
-
ATP + L-glutamine + tRNAGln = AMP + diphosphate + L-glutaminyl-tRNAGln
649850, 651246, 653817, 690792, 703714, 650553, 672181, 672564, 652015, 652212, 653184, 659311, 653922, 672644, 677060, 694903, 726984, 745576, 676219, 728154, 745552, 743985, 745927, 746368, 663214
-
ATP + UTP + L-glutamine = ADP + phosphate + CTP + L-glutamate
-
ATP + deamido-NAD+ + L-glutamine + H2O = AMP + diphosphate + NAD+ + L-glutamate
-
adenosylcobyrinic acid a,c-diamide + ATP + L-glutamine + H2O = adenosylcobyric acid + ADP + phosphate + L-glutamate
-
ATP + adenosylcobyrinic acid a,c-diamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
ATP + Ni-sirohydrochlorin + L-glutamine + H2O = ADP + phosphate + Ni-sirohydrochlorin a,c-diamide + L-glutamate
-
ATP + beta-D-GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)-diphospho-ditrans,octacis-undecaprenol + L-glutamine + H2O = ADP + phosphate + beta-D-GlcNAc-(1->4)-MurNAc-L-Ala-D-isoglutaminyl-L-Lys-D-Ala-D-Ala-diphospho-ditrans,octacis-undecaprenol + L-glutamate
-
ATP + xanthosine 5'-phosphate + L-glutamine + H2O = AMP + diphosphate + GMP + L-glutamate
-
ATP + XMP + L-glutamine + H2O = AMP + diphosphate + GMP + L-glutamate
-
5'-phosphoribosylformylglycinamide + L-glutamine + ATP = phosphoribosylformylglycinamidine + L-glutamate + ADP + phosphate
-
ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
-
formylglycinamide ribonucleotide + ATP + L-glutamine + H2O = formylglycinamidine ribonucleotide + ADP + phosphate + L-glutamate
-
ATP + L-aspartate + L-glutamine + H2O = AMP + diphosphate + L-asparagine + L-glutamate
-
ATP + L-aspartate + L-glutamine = AMP + diphosphate + L-asparagine + L-glutamate
-
2 ATP + L-Gln + HCO3- + H+ + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
2 ATP + L-Gln + HCO3- = 2 ADP + phosphate + L-Glu + carbamoyl phosphate
649849, 649986, 650020, 650110, 650512, 651471, 649994, 651548, 650875, 651882, 652788, 652823, 652660, 651217, 652028, 651388, 652351, 649883, 649886, 649895, 652201, 652334, 652418, 650927, 650936, 650798
-
2 ATP + L-glutamine + HCO3- + H2O + H+ = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
2 ATP + L-glutamine + HCO3- + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + L-glutamine + HCO3- + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + L-glutamine + HCO3- + H2O = ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + Asp-tRNAAsn + L-glutamine + H2O = ADP + phosphate + Asn-tRNAAsn + L-glutamate
-
ATP + L-aspartyl-tRNAAsn + L-glutamine = ADP + phosphate + L-asparaginyl-tRNAAsn + L-glutamate
-
ATP + Glu-tRNAGln + L-glutamine + H2O = ADP + phosphate + Gln-tRNAGln + L-glutamate
-
ATP + Glu-tRNAGln + L-glutamine = ADP + phosphate + Gln-tRNAGln + L-glutamate
-
5'-deoxy-5'-adenosyl-cobyrinic acid + 2 ATP + 2 glutamine + 2 H2O = 5'-deoxy-5'-adenosyl-cobyrinic acid ac-diamide + 2 ADP + 2 phosphate + 2 glutamate
-
ATP + cobyrinic acid + L-glutamine + H2O = ADP + phosphate + cobyrinic acid a,c-diamide + L-glutamate
-
ATP + hydrogenobyrinic acid + L-glutamine + H2O = ADP + phosphate + hydrogenobyrinic acid a,c-diamide + L-glutamate
-
In Vivo Product in Enzyme-catalyzed Reactions (13 results)
EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
2 L-glutamate + 2 oxidized ferredoxin = L-glutamine + 2-oxoglutarate + 2 reduced ferredoxin + 2 H+
-
5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O
-
ATP + H2O + L-glutamine-[L-glutamine-binding protein][side 1] = ADP + phosphate + L-glutamine[side 2] + [L-glutamine-binding protein][side 1]
-
Substrate in Enzyme-catalyzed Reactions (348 results)
EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-glutamine + 2-oxoglutarate + acetylpyridine-NADPH + H+ = L-glutamate + acetylpyridine-NADP+
-
L-glutamine + 2-oxoglutarate + NADPH + H+ = L-glutamate + NADP+
391464, 391459, 391441, 391442, 391439, 391453, 391444, 391463, 391465, 391466, 391467, 391469, 391445, 391452, 391450, 391461, 687801, 391438, 391447, 391449, 391448, 391457, 391460, 391451, 391454, 391440, 391455, 391446, 391468, 391456, 391443, 391458, 391462, 745714
-
L-glutamine + 2-oxoglutarate + NADPH = L-glutamate + NADP+
-
L-glutamine + 2-oxoglutarate + NADH + H+ = L-glutamate + NAD+
-
L-glutamine + 2-oxoglutarate + NADH = glutamate + NAD+
391495, 391485, 391491, 391492, 391490, 391494, 391476, 391474, 391473, 392019, 391489, 391480, 391481, 391479, 391470, 391471, 391472, 391483
-
L-glutamine + 2-oxoglutarate + NADH = L-glutamate + NAD+
689483, 391488, 687217, 689786, 391493, 391476, 391481, 690128, 686702, 687063, 391495, 391472, 391494, 391490, 391491, 391489, 689494, 688085, 686427, 391482, 391480, 391483, 391460, 391475, 391470, 391474, 391486, 391484, 391485, 391471, 391479, 391477, 391473, 392019, 391492, 676596
-
L-glutamine + 2-oxoglutarate + reduced form of 3-acetylpyridine adenine dinucleotide = L-glutamine + oxidized form of 3-acetylpyridine adenine dinucleotide
-
L-glutamine + H2O + O2 = 2-oxo-4-carbamoylbutanoic acid + NH3 + H2O2
-
L-glutamine + H2O + O2 = 2-oxoglutaramate + NH3 + H2O2
-
L-glutamine + 2-oxoglutarate + 2 reduced ferredoxin + 2 H+ = 2 L-glutamate + 2 oxidized ferredoxin
-
L-glutamine + 2-oxoglutarate + 2 reduced methyl viologen + 2 H+ = 2 L-glutamate + 2 oxidized methyl viologen
-
L-glutamine + 2-oxoglutarate + 2 reduced methyl viologen = 2 L-glutamate + 2 oxidized methyl viologen
-
L-glutamine + 2-oxoglutarate + reduced bacterial ferredoxin 1 = L-glutamate + oxidized bacterial ferredoxin 1
-
L-glutamine + 2-oxoglutarate + reduced bacterial ferredoxin 2 = L-glutamate + oxidized bacterial ferredoxin 2
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin + H+ = L-glutamate + oxidized ferredoxin
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin + NADPH + H+ = L-glutamate + oxidized ferredoxin + NADP+
-
L-glutamine + 2-oxoglutarate + reduced ferredoxin = L-glutamate + oxidized ferredoxin
392022, 392001, 392004, 392019, 392026, 392002, 392006, 392013, 392020, 392021, 392017, 392007, 392008, 392014, 392012, 392003, 392005, 392011, 391450, 392018, 392028, 392030, 723865, 392016, 392009, 686702, 392010
-
L-glutamine + 2-oxoglutarate + reduced iodonitrotetrazolium + H+ = L-glutamate + oxidized iodonitrotetrazolium
-
L-glutamine + 2-oxoglutarate + reduced methyl viologen + H+ = L-glutamate + oxidized methyl viologen
-
L-glutamine + 2-oxoglutarate + reduced methylviologen = L-glutamate + oxidized methylviologen
392022, 392002, 392006, 392020, 392021, 392028, 674324, 392026, 392001, 392004, 392010, 392019, 392017, 392007, 392008, 392014, 392012, 392003, 392005, 392011, 391450, 392018, 392009, 391469, 392013
-
5-L-glutamyl-4-nitroanilide + L-glutamine = 4-nitroaniline + 5-L-glutamyl-L-glutamine
487902, 487937, 487938, 487942, 487914, 487930, 487936, 487969, 487907, 487911, 487923, 487924, 487926, 487947, 487951, 487903, 487920, 487899
-
L-gamma-glutamyl-4-nitroanilide + L-glutamine = 4-nitroaniline + 5-L-glutamyl-L-glutamine
-
4-hydrazinobenzoic acid + L-glutamine = beta-N-(gamma-L-glutamyl)-4-carboxyphenylhydrazine
-
L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O = 5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate
-
L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O = 5-phospho-beta-D-ribosylamine + L-glutamate + diphosphate
489755, 489762, 489754, 489748, 489749, 489753, 489759, 489747, 489752, 489757, 489745, 489751, 489771, 489761, 489756, 489746, 489750, 489760, 489758
-
L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O = L-glutamate + 5-phospho-beta-D-ribosylamine + diphosphate
-
L-glutamine + 2-deoxy-scyllo-inosose = 2-oxoglutaramate + 2-deoxy-scyllo-inosamine
-
L-glutamine + 3-amino-2,3-dideoxy-scyllo-inosose = 2-oxoglutaramate + 2-deoxystreptamine
-
L-glutamine + 4-(methylsulfanyl)-2-oxobutanoate = 2-oxoglutaramate + L-methionine
-
chorismate + 2 L-glutamine + H2O = 4-amino-4-deoxychorismate + 2 L-glutamate + ammonia
-
glyoxylate + L-glutamine = glycine + 2-oxoglutaramate
-
L-glutamine + alpha-keto acid = alpha-ketoglutarate + amino acid
-
L-glutamine + D-fructose 6-phosphate = L-glutamate + D-glucosamine 6-phosphate
639909, 639910, 639918, 661954, 639908, 639915, 674058, 639911, 639916, 639917, 639930, 672444, 673687, 677033, 684404, 721419, 639922, 639914, 639925, 671032, 675194, 685109, 639905, 639907, 639912, 639919, 639924, 639931, 639921, 674422, 722052, 639906, 639920, 639904, 758898, 671089, 671603, 671896, 723015, 676955, 639913, 674073, 684758, 672619, 674745, 722779, 737433, 758967, 760122, 706608, 703705, 737920, 756261, 758961, 759211, 639923, 639932
-
dTDP-4-dehydro-6-deoxy-D-glucose + L-glutamine = dTDP-4-amino-4,6-dideoxy-D-galactose + 2-oxoglutamine
-
myo-inositol + glutamine + oxalacetate = amino-deoxyinositol + 2-oxoglutarate + malate + NH4+
-
2-deoxy-scyllo-inosose + L-glutamine = 2-deoxy-scyllo-inosamine + 2-ketoglutaramate
-
2-deoxy-scyllo-inosose + L-glutamine = 2-deoxy-scyllo-inosamine + 2-oxoglutaramate
-
L-glutamine + 1D-4-keto-myo-inositol = 2-oxoglutaramate + amino-deoxy-1D-4-keto-myo-inositol
-
L-glutamine + 2,4,6/3,5-pentahydroxycyclohexanone = 2-oxoglutaramate + 1-amino-1-deoxy-scyllo-inositol
-
L-glutamine + 1D-1-guanidino-1-deoxy-3-dehydro-scyllo-inositol = alpha-ketoglutaramate + 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol
-
dTDP-4-dehydro-6-deoxy-D-glucose + L-glutamine = dTDP-4-amino-4,6-dideoxy-D-galactose + 2-oxoglutaramate
-
L-glutamine + 4-methylsulfanyl-2-oxobutanoate = 2-oxoglutaramate + L-methionine
-
L-glutamine + glyoxylate = 2-oxoglutaramate + glycine
-
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
-
L-glutamine + pyruvate = 2-oxoglutaramate + L-alanine
-
L-glutamine + 4-methylsulfanyl-2-oxobutanoate = 2-oxoglutarate + L-methionine
-
chorismate + L-glutamine = 4-amino-4-deoxychorismate + L-glutamate
-
chorismate + L-glutamine = L-glutamate + 4-amino-4-deoxychorismate
-
chorismate + L-glutamine = (2S)-2-amino-4-deoxychorismate + L-glutamate
-
3-(imidazol-4-yl)-2-oxopropyl phosphate + L-glutamine = L-histidinol phosphate + 4-carbamoyl-2-oxobutanoate
-
L-glutamine + 7-cyano-7-carbaguanine15 in tRNA + H2O = L-glutamate + archaeine15 in tRNA
-
ATP + L-glutamine + H2O = AMP + phosphate + N5-phospho-L-glutamine
-
L-Gln + H2O = L-Glu + NH3
208953, 657311, 208949, 208962, 655078, 666995, 669561, 208941, 208960, 208945, 208952, 208946, 208950
-
L-glutamine + H2O = L-glutamate + NH3
720205, 735338, 734492, 733171, 712512, 720973, 723942, 735144, 733138, 755328, 753459, 754438, 754421, 755459, 755467, 755075
-
Gln + H2O = Glu + NH3
209027, 209035, 209036, 209021, 209024, 209014, 209031, 209009, 209010, 209012, 209013, 209015, 209016, 209017, 209018, 209019, 209028, 209029, 209030, 209033, 209034, 209025, 209020, 209022, 209023, 209026, 209032, 209011
-
L-Gln + H2O = L-Glu + NH3
-
L-glutamine + H2O = L-glutamate + NH3
668317, 733460, 669950, 733262, 734673, 713599, 656204, 667496, 669694, 670129, 670391, 713112, 713428, 718889, 720942, 734818, 735073, 657262, 667477, 663903, 733133, 755231, 667444, 668534, 687847, 718613, 654884, 733562, 753989, 754315, 669542, 752635, 733187, 668902, 733233, 718925, 752531, 655601, 669739, 713385, 655373, 666994, 670768, 669592, 734440, 735259, 719981, 720975, 733239, 755075, 755388, 656222, 654234, 655542, 689587, 694485, 710791, 711989
-
L-glutamine + H2O = L-glutamate + NH3
687356, 209091, 209093, 209100, 670274, 209097, 209095, 209089, 209090, 209092, 753129, 209098, 209101, 209099, 209103, 209094
-
chorismate + L-Gln = anthranilate + pyruvate + L-glutamate
33279, 33283, 33284, 33301, 33303, 33304, 33308, 33311, 33276, 33306, 33310, 33289, 4604, 33296, 33297, 33299, 666592, 682358, 682362, 33302, 33312, 33281, 33286, 33294, 33300, 33282, 33278, 33295, 33298, 666525, 33309, 33280, 33287, 677912, 33293, 33288, 33290, 666593, 666602, 681139, 682292, 682452, 680467, 677906, 33307, 33313, 33291, 33292, 664871, 33305, 33277
-
chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
650576, 702371, 715843, 746743, 705533, 747843, 728052, 747926, 747400, 747427, 747430, 716407, 748637, 748650, 694016, 649565, 691420, 692505, 694976, 746626, 749037, 747617
-
L-glutamine + N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-monophosphate = L-glutamate + D-erythro-1-(imidazol-4-yl)glycerol phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
L-glutamine + N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate = L-glutamate + D-erythro-1-(imidazol-4-yl)glycerol phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
L-glutamine + N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate = L-glutamate + D-erythro-imidazole-glycerol-phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate + L-glutamine = L-glutamate + D-erythro-1-(imidazol-4-yl)glycerol phosphate + 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
-
5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide + L-glutamine = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide + D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate + L-glutamate
-
D-ribose 5-phosphate + D-glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
-
D-ribose 5-phosphate + glyceraldehyde 3-phosphate + L-glutamine = pyridoxal 5'-phosphate + L-glutamate + 3 H2O + phosphate
-
ATP + L-glutamine + tRNAGln = AMP + diphosphate + L-glutaminyl-tRNAGln
114, 235, 236, 237, 238, 239, 240, 241, 243, 244, 247, 248, 249, 250, 251, 255, 649850, 651246, 653817, 662374, 690792, 703714, 650553, 672181, 672564, 245, 652015, 652212, 242, 253, 254, 661830, 92, 653184, 659057, 659311, 653922, 672644, 677060, 694903, 726984, 745576, 676219, 728154, 745552, 743985, 745927, 746368, 663214, 662631
-
Gln + hydroxylamine + ADP = gamma-Glutamylhydroxamate + NH4+ + ?
-
hydroxylamine + L-glutamine + ATP = L-gamma-glutamyl-hydroxamate + ammonia + ADP
-
ATP + 4-methylene-L-glutamate + glutamine = AMP + diphosphate + glutamate + 4-methylene-L-glutamine
-
ATP + L-glutamine + L-methionine = ADP + phosphate + L-glutaminyl-L-methionine
-
ATP + L-glutamine + L-phenylalanine = ADP + phosphate + L-glutaminyl-L-phenylalanine
-
ATP + L-glutamine + L-tryptophan = ADP + phosphate + L-glutaminyl-L-tryptophan
-
ATP + L-phenylalanine + L-glutamine = ADP + phosphate + L-phenylalanyl-L-glutamine
-
ATP + UTP + Gln + H2O = ADP + CTP + Glu + phosphate
-
ATP + UTP + glutamine = ADP + phosphate + CTP + Glu
-
ATP + UTP + L-glutamine = ADP + phosphate + CTP + L-glutamate
-
ATP + deamido-NAD+ + Gln + hydroxylamine = AMP + diphosphate + hydroxamate analog + ?
-
ATP + deamido-NAD+ + L-Gln = AMP + diphosphate + NAD+ + L-Glu
-
ATP + deamido-NAD+ + L-glutamine + H2O = AMP + diphosphate + NAD+ + L-glutamate
-
adenosylcobyrinic acid a,c-diamide + ATP + L-glutamine + H2O = adenosylcobyric acid + ADP + phosphate + L-glutamate
-
ATP + adenosylcobyrinic acid a,c-diamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
ATP + adenosylcobyrinic acid diamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
ATP + adenosylcobyrinic acid pentaamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
ATP + adenosylcobyrinic acid tetraamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
ATP + adenosylcobyrinic acid triamide + L-glutamine + H2O = ADP + phosphate + adenosylcobyric acid + L-glutamate
-
cobinic acid a,c-diamide + ATP + L-glutamine + H2O = cobinamide + ADP + phosphate + L-glutamate
-
2 ATP + (aq)2cobyrinate + 2 L-glutamine + 2 H2O = 2 ADP + 2 phosphate + (aq)2cobyrinate a,c-diamide + 2 L-glutamate
-
2 ATP + (CN,aq)cobyrinate + 2 L-glutamine + 2 H2O = 2 ADP + 2 phosphate + (CN,aq)cobyrinate a,c-diamide + 2 L-glutamate
-
2 ATP + cobyrinate + 2 L-glutamine + 2 H2O = 2 ADP + 2 phosphate + cobyrinate a,c-diamide + 2 L-glutamate
-
2 ATP + hydrogenobyrinate + 2 L-glutamine + 2 H2O = 2 ADP + 2 phosphate + hydrogenobyrinate a,c-diamide + 2 L-glutamate
-
2 ATP + cobyrinate g-monoamide + L-glutamine + 2 H2O = 2 ADP + phosphate + cobyrinate c,g-diamide + L-glutamate
-
ATP + (CN,aq)cobyrinate c-monoamide + L-glutamine + H2O = ADP + phosphate + (CN,aq)cobyrinate a,c-diamide + L-glutamate
-
ATP + cobyrinate a-monoamide + L-glutamine + H2O = ADP + phosphate + cobyrinate a,c-diamide + L-glutamate
-
ATP + cobyrinate c-monoamide + L-glutamine + H2O = ADP + phosphate + cobyrinate a,c-diamide + L-glutamate
-
ATP + hydrogenobyrinate c-monoamide + L-glutamine + H2O = ADP + phosphate + hydrogenobyrinate a,c-diamide + L-glutamate
-
ATP + Ni-sirohydrochlorin + L-glutamine + H2O = ADP + phosphate + Ni-sirohydrochlorin a,c-diamide + L-glutamate
-
ATP + beta-D-GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)-diphospho-ditrans,octacis-undecaprenol + L-glutamine + H2O = ADP + phosphate + beta-D-GlcNAc-(1->4)-MurNAc-L-Ala-D-isoglutaminyl-L-Lys-D-Ala-D-Ala-diphospho-ditrans,octacis-undecaprenol + L-glutamate
-
ATP + glutamate in lipid I + L-glutamine + H2O = ADP + phosphate + glutamine in lipid I + L-glutamate
-
ATP + glutamate in lipid II + L-glutamine + H2O = ADP + phosphate + glutamine in lipid II + L-glutamate
-
ATP + glutamate in lipid II-Gly5 + L-glutamine + H2O = ADP + phosphate + glutamine in lipid II-Gly5 + L-glutamate
-
ATP + XMP + Gln = AMP + diphosphate + GMP + Glu
-
ATP + xanthosine 5'-phosphate + L-glutamine + H2O = AMP + diphosphate + GMP + L-glutamate
-
ATP + XMP + L-glutamine + H2O = AMP + diphosphate + GMP + L-glutamate
-
ATP + 5'-phosphoribosylformylglycinamide + L-Gln + H2O = ADP + phosphate + 5'-phosphoribosylformylglycinamidine + L-Glu
-
ATP + carbocyclic-5'-phosphoribosylformylglycinamide + L-Gln + H2O = ADP + phosphate + carbocyclic-5'-phosphoribosylformylglycinamidine + L-Glu
-
5'-phosphoribosylformylglycinamide + ATP + L-glutamine + H2O = phosphoribosylformylglycinamidine + L-glutamate + ADP + phosphate
-
5'-phosphoribosylformylglycinamide + L-glutamine + ATP = phosphoribosylformylglycinamidine + L-glutamate + ADP + phosphate
-
ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
-
formylglycinamide ribonucleotide + ATP + L-glutamine + H2O = formylglycinamidine ribonucleotide + ADP + phosphate + L-glutamate
-
ATP + L-Asp + L-Gln = AMP + diphosphate + Asn + Glu
1712, 858, 1720, 1680, 1681, 1687, 1713, 1691, 1692, 1693, 1697, 1698, 1699, 1700, 1701, 1702, 1689, 1694, 1695, 1696, 660816, 1673, 1677, 1685, 1688, 1710, 1715, 1718, 1719, 1679, 1708, 1723, 1674, 1676, 1683, 1684, 1707, 1678, 1711, 1714, 1703, 1704, 1672, 1716, 1722, 861, 1721, 1675, 1709, 1705, 1717, 692123, 1682, 1690, 662718, 661295, 661391
-
ATP + L-aspartate + L-glutamine + H2O = AMP + diphosphate + L-asparagine + L-glutamate
671350, 726657, 745756, 716548, 745375, 693410, 716573, 726824, 727578, 746172, 745294, 743980, 745003, 1672
-
ATP + L-aspartate + L-glutamine = AMP + diphosphate + L-asparagine + L-glutamate
650297, 663175, 651646, 649262, 649836, 650022, 653135, 649710, 650733, 653513, 653466, 650394, 653567, 649882, 649482, 651553, 650596, 661315
-
2 ATP + L-Gln + HCO3- + H+ + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
2 ATP + L-Gln + HCO3- = 2 ADP + phosphate + L-Glu + carbamoyl phosphate
1736, 660964, 650289, 1725, 1739, 1740, 1752, 1756, 1757, 651901, 651952, 1751, 652201, 1729, 1731, 1738, 1741, 1742, 1744, 1746, 1748, 1749, 1750, 1754, 1755, 649457, 649849, 649877, 649883, 649886, 649895, 649964, 649986, 650020, 650110, 650512, 650798, 650936, 651292, 651471, 651882, 651937, 652028, 652334, 652351, 652418, 652788, 652823, 660796, 662650, 663329, 663332, 672238, 649994, 650927, 662971, 675159, 1735, 1737, 1743, 1745, 1747, 1753, 1730, 1733, 1726, 1727, 1728, 1732, 1734, 652660, 651548, 651217, 650875, 651388, 652791, 661134, 663345
-
2 ATP + L-glutamine + HCO3- + H2O + H+ = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
2 ATP + L-glutamine + HCO3- + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + L-glutamine + HCO3- + H2O = 2 ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + L-glutamine + HCO3- + H2O = ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + L-glutamine + hydrogencarbonate + H2O = ADP + phosphate + L-glutamate + carbamoyl phosphate
-
ATP + Asp-tRNAAsn + glutamine = ADP + phosphate + Asn-tRNAAsn + glutamate
-
ATP + Glu-tRNAGln + glutamine = ADP + Gln-tRNAGln + glutamate + phosphate
-
ATP + Asp-tRNAAsn + L-glutamine + H2O = ADP + phosphate + Asn-tRNAAsn + L-glutamate
-
ATP + Asp-tRNAAsn + L-glutamine = ADP + phosphate + Asn-tRNAAsn + L-glutamate
-
ATP + L-aspartyl-tRNAAsn + L-glutamine + H2O = ADP + phosphate + L-asparaginyl-tRNAAsn + L-glutamate
-
ATP + L-aspartyl-tRNAAsn + L-glutamine = ADP + phosphate + L-asparaginyl-tRNAAsn + L-glutamate
-
ATP + Asp-tRNAAsn + L-glutamine = ADP + phosphate + Asn-tRNAAsn + L-glutamate
-
ATP + Glu-tRNAGln + L-glutamine + H2O = ADP + phosphate + Gln-tRNAGln + L-glutamate
-
ATP + Glu-tRNAGln + L-glutamine = ADP + phosphate + Gln-tRNAGln + L-glutamate
492308, 492306, 492303, 492310, 492305, 716371, 692759, 706514, 492304, 492307, 492302, 492291, 662450, 674787
-
ATP + L-aspartyl-tRNAAsn + L-glutamine + H2O = ADP + phosphate + L-asparaginyl-tRNAAsn + L-glutamate
-
ATP + L-glutamyl-tRNAGln + L-glutamine = ADP + phosphate + L-glutaminyl-tRNAGln + L-glutamate
-
5'-deoxy-5'-adenosyl-cobyrinic acid + 2 ATP + 2 glutamine + 2 H2O = 5'-deoxy-5'-adenosyl-cobyrinic acid ac-diamide + 2 ADP + 2 phosphate + 2 glutamate
-
adenosyl-cobyrinic acid pentaamide + ATP + glutamine + H2O = ADP + glutamate + phosphate + ?
-
adenosyl-cobyrinic acid tetraamide + ATP + glutamine + H2O = ADP + glutamate + phosphate + ?
-
adenosyl-cobyrinic acid triamide + ATP + glutamine + H2O = ADP + glutamate + phosphate + ?
-
ATP + (CN,aq)cobyrinic acid + glutamine + H2O = ADP + phosphate + (CN,aq)cobyrinic acid-c-monoamide + ?
-
cobyrinic acid + ATP + glutamine = cobyrinic acid a,c-diamide + ADP + phosphate + glutamate
-
cobyrinic acid c-monoamide + ATP + glutamine = cobyrinic acid a,c-diamide + ADP + phosphate + glutamate
-
ATP + adenosyl-cobyrinic acid a,c-diamide + L-glutamine + H2O = ADP + phosphate + ?
-
ATP + cobyrinic acid + L-glutamine + H2O = ADP + phosphate + cobyrinic acid a,c-diamide + L-glutamate
-
ATP + hydrogenobyrinic acid + L-glutamine + H2O = ADP + phosphate + hydrogenobyrinic acid a,c-diamide + L-glutamate
-
Product in Enzyme-catalyzed Reactions (111 results)
EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
L-glutamine + 2-oxoglutarate + reduced form of 3-acetylpyridine adenine dinucleotide = L-glutamine + oxidized form of 3-acetylpyridine adenine dinucleotide
-
L-glutamate + 3-acetylpyridine-NAD+ = L-glutamine + 2-oxoglutarate + 3-acetylpyridine-NADH + H+
-
2 L-glutamate + 2 oxidized ferredoxin = L-glutamine + 2-oxoglutarate + 2 reduced ferredoxin + 2 H+
-
5-L-glutamyl-L-alanine + 5-L-glutamyl-L-alanine = L-glutamine + 5-L-glutamyl-L-glutamyl-L-alanine
-
5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O
-
2-oxoglutaramate + L-glutamic acid 4-benzylester = L-glutamine + 2-oxopentane-1,5-dioic acid benzyl ester
-
2-oxoglutaramate + L-methionine (SR)-sulfoxide = L-glutamine + 4-methylsulfinyl-2-oxobutanoate
-
2-oxoglutaramate + L-methionine = L-glutamine + 4-methylsulfanyl-2-oxobutanoate
-
2-oxoglutaramate + L-methionine sulfone = L-glutamine + 4-methylsulfonyl-2-oxobutanoate
-
N3-methyl-2-deoxystreptamine + 2-oxoglutaramate = 3-methylamino-2-deoxy-scyllo-inositol + L-glutamine
-
L-Gln-7-amido-4-carbamoylmethylcoumarin + H2O = L-Gln + 7-amino-4-carbamoylmethylcoumarin
-
L-Gln-Pro-7-amido-4-carbamoylmethylcoumarin + H2O = L-Gln + Pro-7-amido-4-carbamoylmethylcoumarin
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVN + Gln + HLCGSHL + VEALY + LVCGERGF + FYTPKA
-
(E)-3-methyl-2-hexenoyl-L-glutamine + H2O = L-glutamine + (E)-3-methyl-2-hexenoic acid
-
3-methyl-3-hydroxyhexanoyl-L-glutamine + H2O = L-glutamine + 3-methyl-3-hydroxyhexanoic acid
-
N-(E)-3-methyl-2-hexenoyl-L-glutamine + H2O = (E)-3-methyl-2-hexenoyl-glutamine + L-glutamine
-
N-3-methyl-3-hydroxy-hexanoyl-L-glutamine + H2O = 3-methyl-3-hydroxy-hexanoate + L-glutamine
-
5-L-glutamyl-L-glutamine = 5-oxoproline + L-glutamine
-
ATP + H2O + L-glutamine-[L-glutamine-binding protein][side 1] = ADP + phosphate + L-glutamine[side 2] + [L-glutamine-binding protein][side 1]
-
Activator in Enzyme-catalyzed Reactions (36 results)
EC NUMBER
COMMENTARY
LITERATURE
ENZYME 3D STRUCTURE
C-terminal truncation constructs are dependent on Gln for full adenylylation activity
-
wild-tpye AT needs both signal transduction protein PII and Gln to stimulate full adenylylation activity
-
the adenylyltransferase reaction is activated by glutamine and by the unmodified form of the PII signal transduction protein and is inhibited by the uridylylated form of PII, PII-UMP. PII, PII-UMP, and glutamine shift the enzyme among at least six different enzyme forms, two of which are inactive, one of which exhibits adenylyl-removing activity, and three of which exhibit adenylyltranferase activity. The PII, PII-UMP, and glutamine binding sites are in communication. Glutamine and PII-UMP compete for the enzyme
-
adenylyltransferase reaction is activated by glutamine, enzyme contains one site for glutamine, sites of signal transduction protein PII, signal transduction protein PII-UMP and glutamine are in communication, glutamine favours binding of signal transduction protein PII but competes with signal transduction protein PII-UMP for the enzyme
-
establishes feed-back control by stimulating the adenylylation and inactivation of the [L-glutamate:ammonia ligase (ADP-forming)]
-
in presence of saturating amounts of PIIA protein Mg2+-supported activity is activated, Mn2+-supported activity is almost unchanged
-
the presence of glutamine results in increased uridylyl-removing enzyme (UR) activity of GlnD (maximal activity at 2 mM), while it inhibits the uridylyl transferase (UTase) activity of GlnD
-
stimulates the deuridylylation reaction but in contrast to Escherichia coli glutamine has no effect on the uridylylation reaction
-
isoenzyme PEPC1 is inactivated more than 4fold by 2 mM, 8% activation of isoenzyme PEPC2
-
Inhibitor in Enzyme-catalyzed Reactions (72 results)
EC NUMBER
COMMENTARY
LITERATURE
ENZYME 3D STRUCTURE
activity of NADH-GOGAT I significantly decreases in the presence of 10 mM glutamine
-
strong inhibition of KAT I, phenylpyruvate, 2-oxo-4-methiolbutyrate or 2-oxo-isocaproate protect
-
the presence of glutamine results in increased uridylyl-removing enzyme (UR) activity of GlnD, while it inhibits the uridylyl transferase (UTase) activity of GlnD
-
glutamine inhibition of the adenylyl-removing activity involves intramolecular signaling between the adenylyltransferase and adenylyl-removing domains
-
the adenylyl-removing reaction is activated by PII-UMP and is inhibited by glutamine and by PII. PII, PII-UMP, and glutamine shift the enzyme among at least six different enzyme forms, two of which are inactive, one of which exhibits adenylyl-removing activity, and three of which exhibit adenylyltranferase activity. The PII, PII-UMP, and glutamine binding sites are in communication. Glutamine and PII-UMP compete for the enzyme
-
product inhibition, strongly inhibits the membrane-associated enzyme, while the soluble form is not or weakly inhibited
-
feed-back inhibition of wild-type enzyme, mutant S186F enzyme is resistant to feedback inhibition
-
feedback inhibition of isozymes GSI-alpha and GSI-beta. Feedback inhibition arises from a hydrogen bond network between Gln, the catalytic glutamate, and the GSI-alpha-specific residue, Arg62, from an adjacent subunit. Arg62 must be ejected for proper active site reorganization. An R62A mutation abrogates Gln feedback inhibition but does not affect catalysis
-
the enzyme is feedback inhibited, the feedback inhibition of GS induces the sequence-specific binding of transcription factor GlnR to DNA in nitrogen metabolism regulation by 32fold and reduces the dissociation rate by 18fold stabilizing the complexes, overview
-
inhibitor of the NH4+-dependent reaction catalyzed by both the C1A and C1S mutants of AS-B
-
Enzyme Kinetic Parameters
kcat Value (Turnover Number) (303 results)
EC NUMBER
TURNOVER NUMBER [1/S]
TURNOVER NUMBER MAXIMUM [1/S]
COMMENTARY
LITERATURE
0.28
-
mutant enzyme V605L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.38
-
mutant enzyme A602L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.97
-
wild type enzyme, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
1.55
-
mutant enzyme W74L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
3.02
-
mutant enzyme W74A, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
7.17
-
mutant enzyme W74F, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
17.17
-
wild type enzyme, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.22
-
p-aminobenzoate or pyruvate production in the presence of glutamine (assay contains 4-amino-4-desoxychorismate lyase), pH 8.0, 37°C
0.51
-
wild-type, pH not specified in the publication, temperature not specified in the publication
0.53
-
mutant N24S, pH not specified in the publication, temperature not specified in the publication
821.7
-
pH 7.5, 30°C, protease-cleaved large enzyme fragment, in presence of 2.6 M NaCl
0.00075
-
pH not specified in the publication, temperature not specified in the publication
138
-
wild-type, at 25°C, in 100 mM phosphate buffer, pH 7.0, with 20 mM L-glutamine and 5 mM MgCl2
152
-
mutant Q147K, at 25°C, in 100 mM phosphate buffer, pH 7.0, with 20 mM L-glutamine and 5 mM MgCl2
0.025
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme K258A
0.16
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme K258R
0.49
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme K360A
1.13
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme K360R
6
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme R239H
6.9
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme R239A
6.9
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, wild-type enzyme
9
-
pH 7.0, 30°C, cosubstrate: N1-[(5'-phosphoribulosyl)formimino]-5-aminoimidazole-4-carboxamido-1-beta-D-ribofuranosyl 5'-phosphate, mutant enzyme R239K
-999
-
pH 7.0, 25°C, kinetic constants are determined for wild-type and mutant enzymes
0.18
-
pH 8.0, 37°C, HisF mutant enzyme D98A, activated by 1 mM 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
0.24
-
pH 8.0, 37°C, HisF mutant enzyme V48A, activated by 1 mM 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
0.57
-
pH 8.0, 37°C, HisF mutant enzyme K19A, activated by 1 mM 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
1.88
-
pH 8.0, 37°C, HisF mutant enzyme V12A, activated by 1 mM 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
3.62
-
pH 8.0, 37°C, wild-type enzyme, activated by 1 mM 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
4.09
-
pH 8.0, 30°C, activated by 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
4.37
-
pH 8.0, 40°C, activated by 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
4.89
-
pH 8.0, 50°C, activated by 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
5.5
-
pH 8.0, 60°C, activated by 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
5.92
-
pH 8.0, 70°C, activated by 5-[(5-phospho-1-deoxy-D-ribulos-1-ylamino)methylideneamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide
0.022
-
Pdx2 glutaminase activity, His-tagged H115A mutant Pdx1 protein, pH 7.5, 37°C
0.024
-
Pdx2 glutaminase activity, His-tagged H115A/R138A mutant Pdx1 protein, pH 7.5, 37°C
0.024
-
Pdx2 glutaminase activity, His-tagged K187A mutant Pdx1 protein, pH 7.5, 37°C
0.024
-
Pdx2 glutaminase activity, His-tagged R138A mutant Pdx1 protein, pH 7.5, 37°C
0.026
-
Pdx2 glutaminase activity, His-tagged E105D mutant Pdx1 protein, pH 7.5, 37°C
0.1
-
mutant M174E/M378E, glutaminase activity pH 7.6, temperature not specified in the publication
0.13
-
mutant I18W/A23F/C24F, glutaminase activity pH 7.6, temperature not specified in the publication
0.13
-
mutant M378E, glutaminase activity pH 7.6, temperature not specified in the publication
0.14
-
mutant M911E, glutaminase activity pH 7.6, temperature not specified in the publication
0.15
-
mutant M174E, glutaminase activity pH 7.6, temperature not specified in the publication
0.21
-
mutant A23K, glutaminase activity pH 7.6, temperature not specified in the publication
0.84
-
mutant L720E, glutaminase activity pH 7.6, temperature not specified in the publication
1.08
-
mutant A23F, glutaminase activity pH 7.6, temperature not specified in the publication
1.3
-
mutant L648E, glutaminase activity pH 7.6, temperature not specified in the publication
2.2
-
wild-type, glutaminase activity pH 7.6, temperature not specified in the publication
3
-
mutant G575F, glutaminase activity pH 7.6, temperature not specified in the publication
3.1
-
mutant G575K, glutaminase activity pH 7.6, temperature not specified in the publication
KM Value (615 results)
EC NUMBER
KM VALUE [MM]
KM VALUE MAXIMUM [MM]
COMMENTARY
LITERATURE
0.102
-
in the presence of a fixed concentration of NADPH, and varied concentrations of alpha-ketoglutarate
0.108
-
in the presence of a fixed concentration of NADH, and varied concentrations of alpha-ketoglutarate
0.115
-
in the presence of a fixed concentration of alpha-ketoglutarate, and varied concentrations of NADPH
0.12
-
in the presence of a fixed concentration of alpha-ketoglutarate, and varied concentrations of NADH
0.69
-
dimeric enzyme, at 25°C in 50 mM HEPES/KOH buffer, pH 7.5, 1 M NaCl, in the presence of 2.5 mM 2-oxoglutarate, and 0.1 mM NADPH
2.1
-
hexameric enzyme, at 25°C in 50 mM HEPES/KOH buffer, pH 7.5, 1 M NaCl, in the presence of 2.5 mM 2-oxoglutarate, and 0.1 mM NADPH
0.0013
-
wild-type, pH not specified in the publication, temperature not specified in the publication
0.0018
-
mutant R1162A, pH not specified in the publication, temperature not specified in the publication
0.0027
-
mutant H1144Q, pH not specified in the publication, temperature not specified in the publication
0.0028
-
mutant Q467A, pH not specified in the publication, temperature not specified in the publication
0.0194
-
mutant N1147A, pH not specified in the publication, temperature not specified in the publication
0.023
-
mutant W676A, pH not specified in the publication, temperature not specified in the publication
0.043
-
mutant W676F, pH not specified in the publication, temperature not specified in the publication
1.1
-
in 20 mM NaPO4 (pH 7.2), 1 mM 2-oxoglutarate, 5 mM methylviologen, 5 mM dithionite, at 70°C
0.64
-
N101G mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
1.42
-
N101D mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
1.72
-
wild-type enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
2.43
-
G102A mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
101
-
R73H mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
110
-
R73L mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
236
-
D127A mutant enzyme, 5-phospho-alpha-D-ribose 1-diphosphate-dependent glutaminase activity
0.04
-
mutant enzyme W74L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.048
-
mutant enzyme W74F, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.072
-
mutant enzyme V605L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.1
-
mutant enzyme A602L, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.27
-
wild type enzyme, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.38
-
mutant enzyme W74A, in 50 mM potassium phosphate, pH 7.5, 1 mM EDTA, 50 mM KCl, at 37°C
0.75
-
recombinant enzyme, in 10 mM KCl, 1 mg/ml bovine serum albumin, 20 mM imidazole buffer (pH 6.8), 1 mM EDTA, 1 mM dithiothreitol, and 10% (v/v) glycerol
0.064
-
p-aminobenzoate or pyruvate production in the presence of glutamine (assay contains 4-amino-4-desoxychorismate lyase), pH 8.0, 37°C
3.95
-
wild-type, pH not specified in the publication, temperature not specified in the publication
4.14
-
mutant N24S, pH not specified in the publication, temperature not specified in the publication
46.4
-
wild-type, cooperative kinetic toward L-Gln, Hill coefficient 2.0, pH 7.5, 37°C
76.5
-
mutant Q63E, cooperative kinetic toward L-Gln, Hill coefficient 2.3, pH 7.5, 37°C
3.3
-
recombinant enzyme with N-terminal and C-terminal deletions, T-phosphate buffer, pH 8.0
3.7
-
pH 7.5, 30°C, protease-cleaved large enzyme fragment, in presence of 2.6 M NaCl
5.74
-
pH not specified in the publication, temperature not specified in the publication
6.4
-
recombinant enzyme with N-terminal and C-terminal deletions, T-acetate buffer, pH 8.0
46.4
-
wild-type, cooperative kinetic toward L-Gln, Hill coefficient 2.0, pH 7.5, 37°C
76.5
-
mutant Q63E, cooperative kinetic toward L-Gln, Hill coefficient 2.3, pH 7.5, 37°C
0.129
-
pH not specified in the publication, temperature not specified in the publication