We're sorry, but BRENDA doesn't work properly without JavaScript. Please make sure you have JavaScript enabled in your browser settings.
Information on EC 3.4.23.30 - Pycnoporopepsin for references in articles please use BRENDA:EC3.4.23.30Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
The expected taxonomic range for this enzyme is: Trametes
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Similar to pepsin A, but narrower, cleaving only three bonds in the B chain of insulin: Ala14-/-Leu, Tyr16-/-Leu, and Phe24-/-Phe
-
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
hydrolysis of peptide bond
-
-
aspartic endopeptidase
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
carboxyl proteinase I
-
formerly
EC 3.4.23.6
-
-
formerly
-
EC 3.4.99.25
-
-
formerly
-
Proteinase, Pycnoporus coccineus aspartic
-
-
-
-
Proteinase, Trametes acid
-
-
-
-
Trametes acid proteinase
-
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
a wood-deteriorating basidiomycete, formerly Trametes sanguinea, isozymes Ia and Ib
-
-
brenda
i.e. Pycnoporus coccineus, Trametes sanguinea
-
-
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O
Asp-Arg-Val-Tyr + Ile-His-Pro-Phe-His-Leu-Leu + Val-Tyr-Ser
-
cleavage of Tyr-Ile and Leu-Val
-
-
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA
-
i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview
-
-
?
Hemoglobin + H2O
?
-
-
-
-
?
Native insulin + H2O
Hydrolyzed insulin
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed
-
-
Oxidized B-chain of insulin + H2O
Hydrolyzed insulin B-chain
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed primarily
-
-
Oxidized insulin peptide B1-B16 + H2O
?
-
hydrolysis at His10-Leu11 and Ala14-Leu15
-
-
-
pro-angiotensin + H2O
?
-
cleavage at Tyr4-Ile5 and Phe8-Phe9, at pH 2.7
-
-
?
Proangiotensin + H2O
?
-
formerly designated angiotensin I, hydrolysis of Tyr4-Ile5
-
-
-
additional information
?
-
Angiotensin + H2O
?
-
cleavage at Tyr4-Ile5, at pH 2.7
-
-
?
Angiotensin + H2O
?
-
formerly designated angiotensin II, hydrolysis of Tyr4-Ile5
-
-
-
additional information
?
-
-
the extracellular enzyme is involved in fungal nutrition from wood
-
-
-
additional information
?
-
-
cleavage site specificity of the isoymes, no activity with isulin A chain, overview
-
-
-
additional information
?
-
-
not: oxidized insulin peptide B15-B24, peptide bonds which have a hydrophobic amino acid in the P1' position are preferentially cleaved
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
?
-
-
the extracellular enzyme is involved in fungal nutrition from wood
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
-
purified isozyme Ia and Ib
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
2.3
-
substrate hemoglobin
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
-
crude enzyme preparation
brenda
-
-
brenda
-
submerged culture
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
-
the isozymes are secreted
-
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
33000 - 34000
-
sedimentation equilibrium centrifugation analysis
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
-
three-dimensional structure and active site structure
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
purified isozymes Ia and Ib from acetone
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
i.e. Pycnoporus coccineus, Trametes sanguinea
-
native isozymes Ia and Ib 30fold to homogeneity from mycel-free culture filtrate, by acetone precipitation, anion exchange chromatograph, ammonium sulfate fractionation, dialysis and crystallization to homogeneity, and further to puritiy by anion exchange and sulfopropyl chromatograpgy, and isoelectric focusing
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Majima, E.; Oda, K.; Murao, S.; Ichishima, E.
Comparative study on the specificities of several fungal aspartic and acidic proteinases towards the tetradecapeptide of a renin substrate
Agric. Biol. Chem.
52
787-793
1988
Trametes sanguinea
-
brenda
Ichishima, E.; Kumagai, H.; Tomoda, K.
Substrate specificity of carboxyl proteinase from Pycnoporus coccineus, a wood-deteriorating fungus
Curr. Microbiol.
3
333-337
1980
Trametes sanguinea
-
brenda
Ichishima, E.; Emi, M.; Majima, E.; Mayumi, Y.; Kumagai, H.; Hayashi, K.; Tomoda, K.
Initial sites of insulin cleavage and stereospecificity of carboxyl proteinases from Aspergillus sojae and Pycnoporus coccineus
Biochim. Biophys. Acta
700
247-253
1982
Trametes sanguinea
brenda
Kumagai, H.; Matsue, M.; Majima, E.; Tomoda, K.; Ichishima, E.
Carboxyl proteinase from the wood deteriorating basidiomycete Pycnoporus coccineus : substrate specificity with oxidized insulin peptide B1 B16 and B15 B24, angiotensin and proangiotensin.
Agric. Biol. Chem.
45
981-985
1981
Trametes sanguinea
brenda
Ichishima, E.
Pycnoporopepsin
Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. )
1
141-143
2004
Trametes coccinea
-
brenda
html completed