spontaneous reaction (0.0.0.0)
alcohol dehydrogenase (1.1.1.1)
alcohol dehydrogenase (NADP+) (1.1.1.2)
(S)-specific secondary alcohol dehydrogenase (1.1.1.B3)
homoserine dehydrogenase (1.1.1.3)
(R)-specific secondary alcohol dehydrogenase (NADH) (1.1.1.B4)
(R,R)-butanediol dehydrogenase (1.1.1.4)
acetoin dehydrogenase (1.1.1.5)
glycerol dehydrogenase (1.1.1.6)
propanediol-phosphate dehydrogenase (1.1.1.7)
glycerol-3-phosphate dehydrogenase (NAD+) (1.1.1.8)
D-xylulose reductase (1.1.1.9)
L-xylulose reductase (1.1.1.10)
D-arabinitol 4-dehydrogenase (1.1.1.11)
L-arabinitol 4-dehydrogenase (1.1.1.12)
L-arabinitol 2-dehydrogenase (1.1.1.13)
L-iditol 2-dehydrogenase (1.1.1.14)
D-iditol 2-dehydrogenase (1.1.1.15)
galactitol 2-dehydrogenase (1.1.1.16)
mannitol-1-phosphate 5-dehydrogenase (1.1.1.17)
inositol 2-dehydrogenase (1.1.1.18)
L-1-amino-2-propanol dehydrogenase (1.1.1.B18)
glucuronate reductase (1.1.1.19)
xylitol dehydrogenase (NAD+) (1.1.1.B19)
glucuronolactone reductase (1.1.1.20)
meso-2,3-butandiol dehydrogenase (1.1.1.B20)
aldose reductase (1.1.1.21)
UDP-glucose 6-dehydrogenase (1.1.1.22)
histidinol dehydrogenase (1.1.1.23)
quinate/shikimate dehydrogenase (NAD+) (1.1.1.24)
norsolorinate ketoreductase (1.1.1.B25)
shikimate dehydrogenase (NADP+) (1.1.1.25)
glyoxylate reductase (1.1.1.26)
L-lactate dehydrogenase (1.1.1.27)
D-lactate dehydrogenase (1.1.1.28)
dTDP-4-dehydro-6-deoxyglucose reductase [NAD(P)H] (1.1.1.B28)
glycerate dehydrogenase (1.1.1.29)
3-hydroxybutyrate dehydrogenase (1.1.1.30)
3-hydroxyisobutyrate dehydrogenase (1.1.1.31)
mevaldate reductase (1.1.1.32)
mevaldate reductase (NADPH) (1.1.1.33)
hydroxymethylglutaryl-CoA reductase (NADPH) (1.1.1.34)
3-hydroxyacyl-CoA dehydrogenase (1.1.1.35)
D-arabinose 1-dehydrogenase (NADP+) (1.1.1.B35)
acetoacetyl-CoA reductase (1.1.1.36)
malate dehydrogenase (1.1.1.37)
hydroxymethylglutaryl-CoA reductase [NAD(P)H] (1.1.1.B38)
malate dehydrogenase (oxaloacetate-decarboxylating) (1.1.1.38)
malate dehydrogenase (decarboxylating) (1.1.1.39)
11beta-hydroxysteroid dehydrogenase (NAD+) (1.1.1.B40)
malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) (1.1.1.40)
isocitrate dehydrogenase (NAD+) (1.1.1.41)
isocitrate dehydrogenase (NADP+) (1.1.1.42)
phosphogluconate 2-dehydrogenase (1.1.1.43)
phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating) (1.1.1.44)
L-gulonate 3-dehydrogenase (1.1.1.45)
L-arabinose 1-dehydrogenase (1.1.1.46)
glucose 1-dehydrogenase [NAD(P)+] (1.1.1.47)
succinate semialdehyde reductase (NADPH) (1.1.1.B47)
D-galactose 1-dehydrogenase (1.1.1.48)
glucose-6-phosphate dehydrogenase (NADP+) (1.1.1.49)
3alpha-hydroxysteroid 3-dehydrogenase (Si-specific) (1.1.1.50)
3(or 17)beta-hydroxysteroid dehydrogenase (1.1.1.51)
3-quinuclidinone reductase (NADPH) (1.1.1.B51)
3-quinuclidinone reductase (NADH) (1.1.1.B52)
3alpha-hydroxycholanate dehydrogenase (NAD+) (1.1.1.52)
3alpha(or 20beta)-hydroxysteroid dehydrogenase (1.1.1.53)
allyl-alcohol dehydrogenase (1.1.1.54)
lactaldehyde reductase (NADPH) (1.1.1.55)
ribitol 2-dehydrogenase (1.1.1.56)
1-tetralone reductase [NADPH] (1.1.1.B57)
fructuronate reductase (1.1.1.57)
L-erythritol 4-phosphate dehydrogenase (1.1.1.B58)
tagaturonate reductase (1.1.1.58)
3-hydroxypropionate dehydrogenase (1.1.1.59)
2-hydroxy-3-oxopropionate reductase (1.1.1.60)
D-sorbitol dehydrogenase (NADP+) (1.1.1.B60)
4-hydroxybutyrate dehydrogenase (1.1.1.61)
17beta-estradiol 17-dehydrogenase (1.1.1.62)
3-quinuclidinone reductase (NADP+) (1.1.1.B63)
testosterone 17beta-dehydrogenase (1.1.1.63)
testosterone 17beta-dehydrogenase (NADP+) (1.1.1.64)
xylitol dehydrogenase (NADP+) (1.1.1.B64)
(R)-mandelate dehydrogenase [NAD(P)+] (1.1.1.B65)
pyridoxine 4-dehydrogenase (1.1.1.65)
acyclic imino acid reductase (1.1.1.B66)
omega-hydroxydecanoate dehydrogenase (1.1.1.66)
mannitol 2-dehydrogenase (1.1.1.67)
5,10-methylenetetrahydrofolate reductase (1.1.1.68)
gluconate 5-dehydrogenase (1.1.1.69)
D-glucuronolactone dehydrogenase (1.1.1.70)
alcohol dehydrogenase [NAD(P)+] (1.1.1.71)
glycerol dehydrogenase (NADP+) (1.1.1.72)
octanol dehydrogenase (1.1.1.73)
D-aminopropanol dehydrogenase (1.1.1.74)
(R)-aminopropanol dehydrogenase (1.1.1.75)
(S,S)-butanediol dehydrogenase (1.1.1.76)
lactaldehyde reductase (1.1.1.77)
methylglyoxal reductase (NADH) (1.1.1.78)
glyoxylate reductase (NADP+) (1.1.1.79)
isopropanol dehydrogenase (NADP+) (1.1.1.80)
hydroxypyruvate reductase (1.1.1.81)
malate dehydrogenase (NADP+) (1.1.1.82)
D-malate dehydrogenase (decarboxylating) (1.1.1.83)
dimethylmalate dehydrogenase (1.1.1.84)
3-isopropylmalate dehydrogenase (1.1.1.85)
ketol-acid reductoisomerase (NADP+) (1.1.1.86)
homoisocitrate dehydrogenase (1.1.1.87)
hydroxymethylglutaryl-CoA reductase (1.1.1.88)
dihydroxyisovalerate dehydrogenase (isomerizing) (1.1.1.89)
aryl-alcohol dehydrogenase (1.1.1.90)
aryl-alcohol dehydrogenase (NADP+) (1.1.1.91)
oxaloglycolate reductase (decarboxylating) (1.1.1.92)
tartrate dehydrogenase (1.1.1.93)
glycerol-3-phosphate dehydrogenase [NAD(P)+] (1.1.1.94)
phosphoglycerate dehydrogenase (1.1.1.95)
diiodophenylpyruvate reductase (1.1.1.96)
3-hydroxybenzyl-alcohol dehydrogenase (1.1.1.97)
(R)-2-hydroxy-fatty-acid dehydrogenase (1.1.1.98)
(S)-2-hydroxy-fatty-acid dehydrogenase (1.1.1.99)
3-oxoacyl-[acyl-carrier-protein] reductase (1.1.1.100)
acylglycerone-phosphate reductase (1.1.1.101)
3-dehydrosphinganine reductase (1.1.1.102)
L-threonine 3-dehydrogenase (1.1.1.103)
4-oxoproline reductase (1.1.1.104)
all-trans-retinol dehydrogenase (NAD+) (1.1.1.105)
pantoate 4-dehydrogenase (1.1.1.106)
pyridoxal 4-dehydrogenase (1.1.1.107)
carnitine 3-dehydrogenase (1.1.1.108)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (1.1.1.109)
aromatic 2-oxoacid reductase (1.1.1.110)
3-(imidazol-5-yl)lactate dehydrogenase (1.1.1.111)
indanol dehydrogenase (1.1.1.112)
L-xylose 1-dehydrogenase (1.1.1.113)
apiose 1-reductase (1.1.1.114)
ribose 1-dehydrogenase (NADP+) (1.1.1.115)
D-arabinose 1-dehydrogenase (NAD+) (1.1.1.116)
D-arabinose 1-dehydrogenase [NAD(P)+] (1.1.1.117)
glucose 1-dehydrogenase (NAD+) (1.1.1.118)
glucose 1-dehydrogenase (NADP+) (1.1.1.119)
galactose 1-dehydrogenase (NADP+) (1.1.1.120)
aldose 1-dehydrogenase (NAD+) (1.1.1.121)
D-threo-aldose 1-dehydrogenase (1.1.1.122)
sorbose 5-dehydrogenase (NADP+) (1.1.1.123)
fructose 5-dehydrogenase (NADP+) (1.1.1.124)
2-deoxy-D-gluconate 3-dehydrogenase (1.1.1.125)
2-dehydro-3-deoxy-D-gluconate 6-dehydrogenase (1.1.1.126)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (1.1.1.127)
L-idonate 2-dehydrogenase (1.1.1.128)
L-threonate 3-dehydrogenase (1.1.1.129)
3-dehydro-L-gulonate 2-dehydrogenase (1.1.1.130)
mannuronate reductase (1.1.1.131)
GDP-mannose 6-dehydrogenase (1.1.1.132)
dTDP-4-dehydrorhamnose reductase (1.1.1.133)
dTDP-6-deoxy-L-talose 4-dehydrogenase (NADP+) (1.1.1.134)
GDP-6-deoxy-D-talose 4-dehydrogenase (1.1.1.135)
UDP-N-acetylglucosamine 6-dehydrogenase (1.1.1.136)
ribitol-5-phosphate 2-dehydrogenase (1.1.1.137)
mannitol 2-dehydrogenase (NADP+) (1.1.1.138)
polyol dehydrogenase (NADP+) (1.1.1.139)
sorbitol-6-phosphate 2-dehydrogenase (1.1.1.140)
15-hydroxyprostaglandin dehydrogenase (NAD+) (1.1.1.141)
D-pinitol dehydrogenase (1.1.1.142)
sequoyitol dehydrogenase (1.1.1.143)
perillyl-alcohol dehydrogenase (1.1.1.144)
3beta-hydroxy-DELTA5-steroid dehydrogenase (1.1.1.145)
11beta-hydroxysteroid dehydrogenase (1.1.1.146)
16alpha-hydroxysteroid dehydrogenase (1.1.1.147)
estradiol 17alpha-dehydrogenase (1.1.1.148)
20alpha-hydroxysteroid dehydrogenase (1.1.1.149)
21-hydroxysteroid dehydrogenase (NAD+) (1.1.1.150)
21-hydroxysteroid dehydrogenase (NADP+) (1.1.1.151)
3alpha-hydroxy-5beta-androstane-17-one 3alpha-dehydrogenase (1.1.1.152)
sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming) (1.1.1.153)
ureidoglycolate dehydrogenase (1.1.1.154)
homoisocitrate dehydrogenase (1.1.1.155)
glycerol 2-dehydrogenase (NADP+) (1.1.1.156)
3-hydroxybutyryl-CoA dehydrogenase (1.1.1.157)
UDP-N-acetylmuramate dehydrogenase (1.1.1.158)
7alpha-hydroxysteroid dehydrogenase (1.1.1.159)
dihydrobunolol dehydrogenase (1.1.1.160)
cholestanetriol 26-monooxygenase (1.1.1.161)
erythrulose reductase (1.1.1.162)
cyclopentanol dehydrogenase (1.1.1.163)
hexadecanol dehydrogenase (1.1.1.164)
2-alkyn-1-ol dehydrogenase (1.1.1.165)
hydroxycyclohexanecarboxylate dehydrogenase (1.1.1.166)
hydroxymalonate dehydrogenase (1.1.1.167)
2-dehydropantolactone reductase (Re-specific) (1.1.1.168)
2-dehydropantoate 2-reductase (1.1.1.169)
3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating) (1.1.1.170)
methylenetetrahydrofolate reductase (NADPH) (1.1.1.171)
2-oxoadipate reductase (1.1.1.172)
L-rhamnose 1-dehydrogenase (1.1.1.173)
cyclohexane-1,2-diol dehydrogenase (1.1.1.174)
D-xylose 1-dehydrogenase (1.1.1.175)
12alpha-hydroxysteroid dehydrogenase (1.1.1.176)
glycerol-3-phosphate 1-dehydrogenase (NADP+) (1.1.1.177)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase (1.1.1.178)
D-xylose 1-dehydrogenase (NADP+, D-xylono-1,5-lactone-forming) (1.1.1.179)
mannonate dehydrogenase (NAD(P)+) (1.1.1.180)
cholest-5-ene-3beta,7alpha-diol 3beta-dehydrogenase (1.1.1.181)
fenchol dehydrogenase (1.1.1.182)
geraniol dehydrogenase (NADP+) (1.1.1.183)
carbonyl reductase (NADPH) (1.1.1.184)
L-glycol dehydrogenase (1.1.1.185)
dTDP-galactose 6-dehydrogenase (1.1.1.186)
GDP-4-dehydro-D-rhamnose reductase (1.1.1.187)
prostaglandin-F synthase (1.1.1.188)
prostaglandin-E2 9-reductase (1.1.1.189)
indole-3-acetaldehyde reductase (NADH) (1.1.1.190)
indole-3-acetaldehyde reductase (NADPH) (1.1.1.191)
long-chain-alcohol dehydrogenase (1.1.1.192)
5-amino-6-(5-phosphoribosylamino)uracil reductase (1.1.1.193)
coniferyl-alcohol dehydrogenase (1.1.1.194)
cinnamyl-alcohol dehydrogenase (1.1.1.195)
15-hydroxyprostaglandin-D dehydrogenase (NADP+) (1.1.1.196)
15-hydroxyprostaglandin dehydrogenase (NADP+) (1.1.1.197)
(+)-borneol dehydrogenase (1.1.1.198)
(S)-usnate reductase (1.1.1.199)
aldose-6-phosphate reductase (NADPH) (1.1.1.200)
7beta-hydroxysteroid dehydrogenase (NADP+) (1.1.1.201)
1,3-propanediol dehydrogenase (1.1.1.202)
uronate dehydrogenase (1.1.1.203)
xanthine dehydrogenase (1.1.1.204)
IMP dehydrogenase (1.1.1.205)
tropinone reductase I (1.1.1.206)
(-)-menthol dehydrogenase (1.1.1.207)
(+)-neomenthol dehydrogenase (1.1.1.208)
3(or 17)alpha-hydroxysteroid dehydrogenase (1.1.1.209)
3beta(or 20alpha)-hydroxysteroid dehydrogenase (1.1.1.210)
long-chain-3-hydroxyacyl-CoA dehydrogenase (1.1.1.211)
3-oxoacyl-[acyl-carrier-protein] reductase (NADH) (1.1.1.212)
3alpha-hydroxysteroid 3-dehydrogenase (Re-specific) (1.1.1.213)
2-dehydropantolactone reductase (Si-specific) (1.1.1.214)
gluconate 2-dehydrogenase (1.1.1.215)
farnesol dehydrogenase (NADP+) (1.1.1.216)
benzyl-2-methyl-hydroxybutyrate dehydrogenase (1.1.1.217)
morphine 6-dehydrogenase (1.1.1.218)
dihydroflavonol 4-reductase (1.1.1.219)
6-pyruvoyltetrahydropterin 2'-reductase (1.1.1.220)
vomifoliol dehydrogenase (1.1.1.221)
(R)-4-hydroxyphenyllactate dehydrogenase (1.1.1.222)
isopiperitenol dehydrogenase (1.1.1.223)
mannose-6-phosphate 6-reductase (1.1.1.224)
chlordecone reductase (1.1.1.225)
4-hydroxycyclohexanecarboxylate dehydrogenase (1.1.1.226)
(-)-borneol dehydrogenase (1.1.1.227)
(+)-sabinol dehydrogenase (1.1.1.228)
diethyl 2-methyl-3-oxosuccinate reductase (1.1.1.229)
3alpha-hydroxyglycyrrhetinate dehydrogenase (1.1.1.230)
15-hydroxyprostaglandin-I dehydrogenase (NADP+) (1.1.1.231)
15-hydroxyicosatetraenoate dehydrogenase (1.1.1.232)
N-acylmannosamine 1-dehydrogenase (1.1.1.233)
flavanone 4-reductase (1.1.1.234)
8-oxocoformycin reductase (1.1.1.235)
tropinone reductase II (1.1.1.236)
hydroxyphenylpyruvate reductase (1.1.1.237)
12beta-hydroxysteroid dehydrogenase (1.1.1.238)
3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) (1.1.1.239)
N-acetylhexosamine 1-dehydrogenase (1.1.1.240)
6-endo-hydroxycineole dehydrogenase (1.1.1.241)
zeatin reductase (1.1.1.242)
carveol dehydrogenase (1.1.1.243)
methanol dehydrogenase (1.1.1.244)
cyclohexanol dehydrogenase (1.1.1.245)
pterocarpin synthase (1.1.1.246)
codeinone reductase (NADPH) (1.1.1.247)
salutaridine reductase (NADPH) (1.1.1.248)
[protein eIF-5A]-deoxyhypusine synthase (1.1.1.249)
D-arabinitol 2-dehydrogenase (1.1.1.250)
galactitol-1-phosphate 5-dehydrogenase (1.1.1.251)
tetrahydroxynaphthalene reductase (1.1.1.252)
pteridine reductase (1.1.1.253)
(S)-carnitine 3-dehydrogenase (1.1.1.254)
mannitol dehydrogenase (1.1.1.255)
fluoren-9-ol dehydrogenase (1.1.1.256)
4-(hydroxymethyl)benzenesulfonate dehydrogenase (1.1.1.257)
6-hydroxyhexanoate dehydrogenase (1.1.1.258)
3-hydroxypimeloyl-CoA dehydrogenase (1.1.1.259)
sulcatone reductase (1.1.1.260)
sn-glycerol-1-phosphate dehydrogenase (1.1.1.261)
4-hydroxythreonine-4-phosphate dehydrogenase (1.1.1.262)
1,5-anhydro-D-fructose reductase (1.1.1.263)
L-idonate 5-dehydrogenase (1.1.1.264)
3-methylbutanal reductase (1.1.1.265)
dTDP-4-dehydro-6-deoxyglucose reductase (1.1.1.266)
1-deoxy-D-xylulose-5-phosphate reductoisomerase (1.1.1.267)
2-(R)-hydroxypropyl-CoM dehydrogenase (1.1.1.268)
2-(S)-hydroxypropyl-CoM dehydrogenase (1.1.1.269)
3beta-hydroxysteroid 3-dehydrogenase (1.1.1.270)
GDP-L-fucose synthase (1.1.1.271)
D-2-hydroxyacid dehydrogenase (NADP+) (1.1.1.272)
vellosimine dehydrogenase (1.1.1.273)
2,5-didehydrogluconate reductase (2-dehydro-D-gluconate-forming) (1.1.1.274)
(+)-trans-carveol dehydrogenase (1.1.1.275)
serine 3-dehydrogenase (NADP+) (1.1.1.276)
3beta-hydroxy-5beta-steroid dehydrogenase (1.1.1.277)
3beta-hydroxy-5alpha-steroid dehydrogenase (1.1.1.278)
(R)-3-hydroxyacid-ester dehydrogenase (1.1.1.279)
(S)-3-hydroxyacid-ester dehydrogenase (1.1.1.280)
GDP-4-dehydro-6-deoxy-D-mannose reductase (1.1.1.281)
quinate/shikimate dehydrogenase [NAD(P)+] (1.1.1.282)
methylglyoxal reductase (NADPH) (1.1.1.283)
S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284)
3''-deamino-3''-oxonicotianamine reductase (1.1.1.285)
isocitrate-homoisocitrate dehydrogenase (1.1.1.286)
D-arabinitol dehydrogenase (NADP+) (1.1.1.287)
xanthoxin dehydrogenase (1.1.1.288)
sorbose reductase (1.1.1.289)
4-phosphoerythronate dehydrogenase (1.1.1.290)
2-hydroxymethylglutarate dehydrogenase (1.1.1.291)
1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming) (1.1.1.292)
tropinone reductase I (1.1.1.293)
chlorophyll(ide) b reductase (1.1.1.294)
momilactone-A synthase (1.1.1.295)
dihydrocarveol dehydrogenase (1.1.1.296)
limonene-1,2-diol dehydrogenase (1.1.1.297)
3-hydroxypropionate dehydrogenase (NADP+) (1.1.1.298)
malate dehydrogenase [NAD(P)+] (1.1.1.299)
NADP-retinol dehydrogenase (1.1.1.300)
D-arabitol-phosphate dehydrogenase (1.1.1.301)
2,5-diamino-6-(ribosylamino)-4(3H)-pyrimidinone 5'-phosphate reductase (1.1.1.302)
diacetyl reductase [(R)-acetoin forming] (1.1.1.303)
diacetyl reductase [(S)-acetoin forming] (1.1.1.304)
UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) (1.1.1.305)
S-(hydroxymethyl)mycothiol dehydrogenase (1.1.1.306)
D-xylose reductase [NAD(P)H] (1.1.1.307)
sulfopropanediol 3-dehydrogenase (1.1.1.308)
phosphonoacetaldehyde reductase (NADH) (1.1.1.309)
(S)-sulfolactate dehydrogenase (1.1.1.310)
(S)-1-phenylethanol dehydrogenase (1.1.1.311)
2-hydroxy-4-carboxymuconate semialdehyde hemiacetal dehydrogenase (1.1.1.312)
sulfoacetaldehyde reductase (NADPH) (1.1.1.313)
germacrene A alcohol dehydrogenase (1.1.1.314)
11-cis-retinol dehydrogenase (1.1.1.315)
L-galactose 1-dehydrogenase (1.1.1.316)
perakine reductase (1.1.1.317)
eugenol synthase (1.1.1.318)
isoeugenol synthase (1.1.1.319)
benzil reductase [(S)-benzoin forming] (1.1.1.320)
benzil reductase [(R)-benzoin forming] (1.1.1.321)
(-)-endo-fenchol dehydrogenase (1.1.1.322)
(+)-thujan-3-ol dehydrogenase (1.1.1.323)
8-hydroxygeraniol dehydrogenase (1.1.1.324)
sepiapterin reductase (L-threo-7,8-dihydrobiopterin forming) (1.1.1.325)
zerumbone synthase (1.1.1.326)
5-exo-hydroxycamphor dehydrogenase (1.1.1.327)
nicotine blue oxidoreductase (1.1.1.328)
2-deoxy-scyllo-inosamine dehydrogenase (1.1.1.329)
very-long-chain 3-oxoacyl-CoA reductase (1.1.1.330)
secoisolariciresinol dehydrogenase (1.1.1.331)
chanoclavine-I dehydrogenase (1.1.1.332)
decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase (1.1.1.333)
methylecgonone reductase (1.1.1.334)
UDP-N-acetyl-2-amino-2-deoxyglucuronate dehydrogenase (1.1.1.335)
UDP-N-acetyl-D-mannosamine dehydrogenase (1.1.1.336)
L-2-hydroxycarboxylate dehydrogenase (NAD+) (1.1.1.337)
(2R)-3-sulfolactate dehydrogenase (NADP+) (1.1.1.338)
dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) (1.1.1.339)
1-deoxy-11beta-hydroxypentalenate dehydrogenase (1.1.1.340)
CDP-abequose synthase (1.1.1.341)
CDP-paratose synthase (1.1.1.342)
phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating) (1.1.1.343)
dTDP-6-deoxy-L-talose 4-dehydrogenase [NAD(P)+] (1.1.1.344)
D-2-hydroxyacid dehydrogenase (NAD+) (1.1.1.345)
2,5-didehydrogluconate reductase (2-dehydro-L-gulonate-forming) (1.1.1.346)
geraniol dehydrogenase (NAD+) (1.1.1.347)
(3R)-2'-hydroxyisoflavanone reductase (1.1.1.348)
norsolorinic acid ketoreductase (1.1.1.349)
ureidoglycolate dehydrogenase (NAD+) (1.1.1.350)
phosphogluconate dehydrogenase [NAD(P)+-dependent, decarboxylating] (1.1.1.351)
5'-hydroxyaverantin dehydrogenase (1.1.1.352)
versiconal hemiacetal acetate reductase (1.1.1.353)
farnesol dehydrogenase (NAD+) (1.1.1.354)
2'-dehydrokanamycin reductase (1.1.1.355)
GDP-L-colitose synthase (1.1.1.356)
3alpha-hydroxysteroid 3-dehydrogenase (1.1.1.357)
2-dehydropantolactone reductase (1.1.1.358)
aldose 1-dehydrogenase [NAD(P)+] (1.1.1.359)
glucose/galactose 1-dehydrogenase (1.1.1.360)
glucose-6-phosphate 3-dehydrogenase (1.1.1.361)
aklaviketone reductase (1.1.1.362)
glucose-6-phosphate dehydrogenase [NAD(P)+] (1.1.1.363)
dTDP-4-dehydro-6-deoxy-alpha-D-gulose 4-ketoreductase (1.1.1.364)
D-galacturonate reductase (1.1.1.365)
L-idonate 5-dehydrogenase (NAD+) (1.1.1.366)
UDP-2-acetamido-2,6-beta-L-arabino-hexul-4-ose reductase (1.1.1.367)
6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase (1.1.1.368)
D-chiro-inositol 1-dehydrogenase (1.1.1.369)
scyllo-inositol 2-dehydrogenase (NAD+) (1.1.1.370)
scyllo-inositol 2-dehydrogenase (NADP+) (1.1.1.371)
D/L-glyceraldehyde reductase (1.1.1.372)
sulfolactaldehyde 3-reductase (1.1.1.373)
UDP-N-acetylglucosamine 3-dehydrogenase (1.1.1.374)
L-2-hydroxycarboxylate dehydrogenase [NAD(P)+] (1.1.1.375)
L-arabinose 1-dehydrogenase [NAD(P)+] (1.1.1.376)
L-rhamnose 1-dehydrogenase (NADP+) (1.1.1.377)
L-rhamnose 1-dehydrogenase [NAD(P)+] (1.1.1.378)
(R)-mandelate dehydrogenase (1.1.1.379)
L-gulonate 5-dehydrogenase (1.1.1.380)
3-hydroxy acid dehydrogenase (1.1.1.381)
ketol-acid reductoisomerase (NAD+) (1.1.1.382)
ketol-acid reductoisomerase [NAD(P)+] (1.1.1.383)
dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase (1.1.1.384)
dihydroanticapsin dehydrogenase (1.1.1.385)
ipsdienol dehydrogenase (1.1.1.386)
L-serine 3-dehydrogenase (NAD+) (1.1.1.387)
glucose-6-phosphate dehydrogenase (NAD+) (1.1.1.388)
2-dehydro-3-deoxy-L-galactonate 5-dehydrogenase (1.1.1.389)
sulfoquinovose 1-dehydrogenase (1.1.1.390)
3beta-hydroxycholanate 3-dehydrogenase (NAD+) (1.1.1.391)
3alpha-hydroxycholanate dehydrogenase (NADP+) (1.1.1.392)
3beta-hydroxycholanate 3-dehydrogenase (NADP+) (1.1.1.393)
aurachin B dehydrogenase (1.1.1.394)
3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase (1.1.1.395)
bacteriochlorophyllide a dehydrogenase (1.1.1.396)
beta-methylindole-3-pyruvate reductase (1.1.1.397)
2-glutathionyl-2-methylbut-3-en-1-ol dehydrogenase (1.1.1.398)
2-oxoglutarate reductase (1.1.1.399)
2-methyl-1,2-propanediol dehydrogenase (1.1.1.400)
2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD+) (1.1.1.401)
D-erythritol 1-phosphate dehydrogenase (1.1.1.402)
D-threitol dehydrogenase (NAD+) (1.1.1.403)
tetrachlorobenzoquinone reductase (1.1.1.404)
ribitol-5-phosphate 2-dehydrogenase (NADP+) (1.1.1.405)
galactitol 2-dehydrogenase (L-tagatose-forming) (1.1.1.406)
D-altritol 5-dehydrogenase (1.1.1.407)
4-phospho-D-threonate 3-dehydrogenase (1.1.1.408)
4-phospho-D-erythronate 3-dehydrogenase (1.1.1.409)
D-erythronate 2-dehydrogenase (1.1.1.410)
L-threonate 2-dehydrogenase (1.1.1.411)
2-alkyl-3-oxoalkanoate reductase (1.1.1.412)
A-factor type gamma-butyrolactone 1'-reductase (1S-forming) (1.1.1.413)
L-galactonate 5-dehydrogenase (NAD+) (1.1.1.414)
noscapine synthase (1.1.1.415)
isopyridoxal dehydrogenase (5-pyridoxolactone-forming) (1.1.1.416)
3beta-hydroxysteroid-4beta-carboxylate 3-dehydrogenase (decarboxylating) (1.1.1.417)
plant 3beta-hydroxysteroid-4alpha-carboxylate 3-dehydrogenase (decarboxylating) (1.1.1.418)
nepetalactol dehydrogenase (1.1.1.419)
D-apiose dehydrogenase (1.1.1.420)
D-apionate oxidoisomerase (1.1.1.421)
pseudoephedrine dehydrogenase (1.1.1.422)
(1R,2S)-ephedrine 1-dehydrogenase (1.1.1.423)
D-xylose 1-dehydrogenase (NADP+, D-xylono-1,4-lactone-forming) (1.1.1.424)
levoglucosan dehydrogenase (1.1.1.425)
UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (1.1.1.426)
D-arabinose 1-dehydrogenase (NADP+) (1.1.1.427)
4-methylthio 2-oxobutanoate reductase (NADH) (1.1.1.428)
(2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase (1.1.1.429)
D-xylose reductase (NADH) (1.1.1.430)
D-xylose reductase (NADPH) (1.1.1.431)
6-dehydroglucose reductase (1.1.1.432)
sulfoacetaldehyde reductase (NADH) (1.1.1.433)
glycerolphosphate dehydrogenase (1.1.2.1)
mannitol dehydrogenase (cytochrome) (1.1.2.2)
quinoprotein methanol dehydrogenase (cytochrome c551i) (1.1.2.B2)
L-lactate dehydrogenase (cytochrome) (1.1.2.3)
quinoprotein methanol dehydrogenase (cytochrome c559) (1.1.2.B3)
D-lactate dehydrogenase (cytochrome) (1.1.2.4)
D-lactate dehydrogenase (cytochrome c-553) (1.1.2.5)
PQQ-dependent quinohemoprotein pyranose dehydrogenase (1.1.2.B5)
polyvinyl alcohol dehydrogenase (cytochrome) (1.1.2.6)
methanol dehydrogenase (cytochrome c) (1.1.2.7)
alcohol dehydrogenase (cytochrome c) (1.1.2.8)
1-butanol dehydrogenase (cytochrome c) (1.1.2.9)
lanthanide-dependent methanol dehydrogenase (1.1.2.10)
glucoside 3-dehydrogenase (cytochrome c) (1.1.2.11)
glycolate oxidase (1.1.3.1)
L-lactate oxidase (1.1.3.2)
malate oxidase (1.1.3.3)
glucose oxidase (1.1.3.4)
glycerol oxidase (1.1.3.B4)
eugenol oxidase (1.1.3.B5)
hexose oxidase (1.1.3.5)
cholesterol oxidase (1.1.3.6)
aryl-alcohol oxidase (1.1.3.7)
L-gulonolactone oxidase (1.1.3.8)
galactose oxidase (1.1.3.9)
pyranose oxidase (1.1.3.10)
L-sorbose oxidase (1.1.3.11)
pyridoxine 4-oxidase (1.1.3.12)
alcohol oxidase (1.1.3.13)
catechol oxidase (dimerizing) (1.1.3.14)
(S)-2-hydroxy-acid oxidase (1.1.3.15)
ecdysone oxidase (1.1.3.16)
choline oxidase (1.1.3.17)
secondary-alcohol oxidase (1.1.3.18)
4-hydroxymandelate oxidase (decarboxylating) (1.1.3.19)
long-chain-alcohol oxidase (1.1.3.20)
glycerol-3-phosphate oxidase (1.1.3.21)
xanthine oxidase (1.1.3.22)
thiamine oxidase (1.1.3.23)
L-galactonolactone oxidase (1.1.3.24)
cellobiose oxidase (1.1.3.25)
columbamine oxidase (1.1.3.26)
hydroxyphytanate oxidase (1.1.3.27)
nucleoside oxidase (1.1.3.28)
N-acylhexosamine oxidase (1.1.3.29)
polyvinyl-alcohol oxidase (1.1.3.30)
methanol oxidase (1.1.3.31)
(S)-stylopine synthase (1.1.3.32)
S-cheilanthifoline synthase (1.1.3.33)
berbamunine synthase (1.1.3.34)
salutaridine synthase (1.1.3.35)
(S)-canadine synthase (1.1.3.36)
D-arabinono-1,4-lactone oxidase (1.1.3.37)
vanillyl-alcohol oxidase (1.1.3.38)
nucleoside oxidase (H2O2-forming) (1.1.3.39)
D-mannitol oxidase (1.1.3.40)
alditol oxidase (1.1.3.41)
prosolanapyrone-II oxidase (1.1.3.42)
paromamine 6'-oxidase (1.1.3.43)
6'''-hydroxyneomycin C oxidase (1.1.3.44)
aclacinomycin-N oxidase (1.1.3.45)
4-hydroxymandelate oxidase (1.1.3.46)
5-(hydroxymethyl)furfural oxidase (1.1.3.47)
3-deoxy-alpha-D-manno-octulosonate 8-oxidase (1.1.3.48)
(R)-mandelonitrile oxidase (1.1.3.49)
C-glycoside oxidase (1.1.3.50)
prostamide synthase (1.1.4.B1)
vitamin-K-epoxide reductase (warfarin-sensitive) (1.1.4.1)
vitamin-K-epoxide reductase (warfarin-insensitive) (1.1.4.2)
cellobiose dehydrogenase (quinone) (1.1.5.1)
quinoprotein inositol dehydrogenase (1.1.5.B1)
glucose 1-dehydrogenase (PQQ, quinone) (1.1.5.2)
quinoprotein alcohol dehydrogenase (1.1.5.B2)
glycerol-3-phosphate dehydrogenase (1.1.5.3)
quinone dependent L-lactate dehydrogenase (1.1.5.B3)
malate dehydrogenase (quinone) (1.1.5.4)
alcohol dehydrogenase (quinone) (1.1.5.5)
formate dehydrogenase-N (1.1.5.6)
cyclic alcohol dehydrogenase (quinone) (1.1.5.7)
quinate/shikimate dehydrogenase (quinone) (1.1.5.8)
glucose 1-dehydrogenase (FAD, quinone) (1.1.5.9)
D-2-hydroxyacid dehydrogenase (quinone) (1.1.5.10)
1-butanol dehydrogenase (quinone) (1.1.5.11)
D-lactate dehydrogenase (quinone) (1.1.5.12)
(S)-2-hydroxyglutarate dehydrogenase (1.1.5.13)
fructose 5-dehydrogenase (1.1.5.14)
4-hydroxybenzoyl-CoA reductase (1.1.7.1)
alcohol dehydrogenase (azurin) (1.1.9.1)
alcohol dehydrogenase (azurin) (1.1.98.1)
glucose-6-phosphate dehydrogenase (coenzyme-F420) (1.1.98.2)
decaprenylphospho-beta-D-ribofuranose 2-dehydrogenase (1.1.98.3)
F420H2:quinone oxidoreductase (1.1.98.4)
secondary-alcohol dehydrogenase (coenzyme-F420) (1.1.98.5)
ribonucleoside-triphosphate reductase (formate) (1.1.98.6)
Ser-type anaerobic sulfatase-maturating enzyme (1.1.98.7)
choline dehydrogenase (1.1.99.1)
flavin adenine dinucleotide-dependent 4-phospho-D-erythronate dehydrogenase (1.1.99.B1)
L-2-hydroxyglutarate dehydrogenase (1.1.99.2)
gluconate 2-dehydrogenase (acceptor) (1.1.99.3)
glucooligosaccharide oxidase (1.1.99.B3)
dehydrogluconate dehydrogenase (1.1.99.4)
glycerol-3-phosphate dehydrogenase (1.1.99.5)
D-lactate dehydrogenase (acceptor) (1.1.99.6)
phosphonoacetaldehyde reductase (acceptor) (1.1.99.B6)
lactate-malate transhydrogenase (1.1.99.7)
menaquinol-acceptor oxidoreductase (1.1.99.B7)
alcohol dehydrogenase (acceptor) (1.1.99.8)
(S)-2-hydroxycarboxylate dehydrogenase (1.1.99.B9)
pyridoxine 5-dehydrogenase (1.1.99.9)
glucose dehydrogenase (acceptor) (1.1.99.10)
fructose 5-dehydrogenase (1.1.99.11)
sorbose dehydrogenase (1.1.99.12)
glucoside 3-dehydrogenase (acceptor) (1.1.99.13)
glycolate dehydrogenase (1.1.99.14)
5,10-methylenetetrahydrofolate reductase (FADH2) (1.1.99.15)
malate dehydrogenase (acceptor) (1.1.99.16)
glucose dehydrogenase (pyrroloquinoline-quinone) (1.1.99.17)
cellobiose dehydrogenase (acceptor) (1.1.99.18)
uracil dehydrogenase (1.1.99.19)
alkan-1-ol dehydrogenase (acceptor) (1.1.99.20)
D-sorbitol dehydrogenase (acceptor) (1.1.99.21)
glycerol dehydrogenase (acceptor) (1.1.99.22)
polyvinyl-alcohol dehydrogenase (acceptor) (1.1.99.23)
hydroxyacid-oxoacid transhydrogenase (1.1.99.24)
quinate dehydrogenase (pyrroloquinoline-quinone) (1.1.99.25)
3-hydroxycyclohexanone dehydrogenase (1.1.99.26)
(R)-pantolactone dehydrogenase (flavin) (1.1.99.27)
glucose-fructose oxidoreductase (1.1.99.28)
pyranose dehydrogenase (acceptor) (1.1.99.29)
2-oxo-acid reductase (1.1.99.30)
(S)-mandelate dehydrogenase (1.1.99.31)
L-sorbose 1-dehydrogenase (1.1.99.32)
formate dehydrogenase (acceptor) (1.1.99.33)
glucose-6-phosphate dehydrogenase (coenzyme-F420) (1.1.99.34)
soluble quinoprotein glucose dehydrogenase (1.1.99.35)
alcohol dehydrogenase (nicotinoprotein) (1.1.99.36)
methanol dehydrogenase (nicotinoprotein) (1.1.99.37)
2-deoxy-scyllo-inosamine dehydrogenase (AdoMet-dependent) (1.1.99.38)
D-2-hydroxyglutarate dehydrogenase (1.1.99.39)
(R)-2-hydroxyglutarate-pyruvate transhydrogenase (1.1.99.40)
3-hydroxy-1,2-didehydro-2,3-dihydrotabersonine reductase (1.1.99.41)
4-pyridoxic acid dehydrogenase (1.1.99.42)
formaldehyde dehydrogenase (glutathione) (1.2.1.1)
formate dehydrogenase (1.2.1.2)
aldehyde dehydrogenase (NAD+) (1.2.1.3)
aldehyde dehydrogenase (NADP+) (1.2.1.4)
aldehyde dehydrogenase [NAD(P)+] (1.2.1.5)
benzaldehyde dehydrogenase (1.2.1.6)
benzaldehyde dehydrogenase (NADP+) (1.2.1.7)
5'-hydroxyaverantin dehydrogenase (NADP+) (1.2.1.B8)
betaine-aldehyde dehydrogenase (1.2.1.8)
glyceraldehyde-3-phosphate dehydrogenase (NADP+) (1.2.1.9)
acetaldehyde dehydrogenase (acetylating) (1.2.1.10)
aspartate-semialdehyde dehydrogenase (1.2.1.11)
glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (1.2.1.12)
glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) (1.2.1.13)
IMP dehydrogenase (1.2.1.14)
malonate-semialdehyde dehydrogenase (1.2.1.15)
succinate-semialdehyde dehydrogenase [NAD(P)+] (1.2.1.16)
glyoxylate dehydrogenase (acylating) (1.2.1.17)
malonate-semialdehyde dehydrogenase (acetylating) (1.2.1.18)
aminobutyraldehyde dehydrogenase (1.2.1.19)
glutarate-semialdehyde dehydrogenase (1.2.1.20)
glycolaldehyde dehydrogenase (1.2.1.21)
lactaldehyde dehydrogenase (1.2.1.22)
2-oxoaldehyde dehydrogenase (NAD+) (1.2.1.23)
4,4'-diaponeurosporen-aldehyde dehydrogenase (1.2.1.B23)
succinate-semialdehyde dehydrogenase (NAD+) (1.2.1.24)
branched-chain alpha-keto acid dehydrogenase system (1.2.1.25)
long-chain-fatty-acyl-CoA reductase (1.2.1.B25)
2,5-dioxovalerate dehydrogenase (1.2.1.26)
methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (1.2.1.27)
benzaldehyde dehydrogenase (NAD+) (1.2.1.28)
aryl-aldehyde dehydrogenase (1.2.1.29)
formate dehydrogenase (NADP+, ferredoxin) (1.2.1.B29)
carboxylate reductase (NADP+) (1.2.1.30)
L-aminoadipate-semialdehyde dehydrogenase (1.2.1.31)
aminomuconate-semialdehyde dehydrogenase (1.2.1.32)
(R)-dehydropantoate dehydrogenase (1.2.1.33)
D-mannonate dehydrognase (NAD(P)+) (1.2.1.34)
uronate dehydrogenase (1.2.1.35)
retinal dehydrogenase (1.2.1.36)
xanthine dehydrogenase (1.2.1.37)
N-acetyl-gamma-glutamyl-phosphate reductase (1.2.1.38)
phenylacetaldehyde dehydrogenase (1.2.1.39)
3alpha,7alpha,12alpha-trihydroxycholestan-26-al 26-oxidoreductase (1.2.1.40)
glutamate-5-semialdehyde dehydrogenase (1.2.1.41)
hexadecanal dehydrogenase (acylating) (1.2.1.42)
formate dehydrogenase (NADP+) (1.2.1.43)
cinnamoyl-CoA reductase (1.2.1.44)
4-carboxy-2-hydroxymuconate-6-semialdehyde dehydrogenase (1.2.1.45)
formaldehyde dehydrogenase (1.2.1.46)
4-trimethylammoniobutyraldehyde dehydrogenase (1.2.1.47)
long-chain-aldehyde dehydrogenase (1.2.1.48)
2-oxoaldehyde dehydrogenase (NADP+) (1.2.1.49)
long-chain acyl-protein thioester reductase (1.2.1.50)
pyruvate dehydrogenase (NADP+) (1.2.1.51)
oxoglutarate dehydrogenase (NADP+) (1.2.1.52)
4-hydroxyphenylacetaldehyde dehydrogenase (1.2.1.53)
gamma-guanidinobutyraldehyde dehydrogenase (1.2.1.54)
(R)-3-hydroxyacid ester dehydrogenase (1.2.1.55)
(S)-3-hydroxyacid ester dehydrogenase (1.2.1.56)
butanal dehydrogenase (1.2.1.57)
phenylglyoxylate dehydrogenase (acylating) (1.2.1.58)
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) (1.2.1.59)
5-carboxymethyl-2-hydroxymuconic-semialdehyde dehydrogenase (1.2.1.60)
4-hydroxymuconic-semialdehyde dehydrogenase (1.2.1.61)
4-formylbenzenesulfonate dehydrogenase (1.2.1.62)
6-oxohexanoate dehydrogenase (1.2.1.63)
4-hydroxybenzaldehyde dehydrogenase (NAD+) (1.2.1.64)
salicylaldehyde dehydrogenase (1.2.1.65)
mycothiol-dependent formaldehyde dehydrogenase (1.2.1.66)
vanillin dehydrogenase (1.2.1.67)
coniferyl-aldehyde dehydrogenase (1.2.1.68)
fluoroacetaldehyde dehydrogenase (1.2.1.69)
glutamyl-tRNA reductase (1.2.1.70)
succinylglutamate-semialdehyde dehydrogenase (1.2.1.71)
erythrose-4-phosphate dehydrogenase (1.2.1.72)
sulfoacetaldehyde dehydrogenase (1.2.1.73)
abieta-7,13-dien-18-al dehydrogenase (1.2.1.74)
malonyl-CoA reductase (malonate semialdehyde-forming) (1.2.1.75)
succinate-semialdehyde dehydrogenase (acylating) (1.2.1.76)
3,4-dehydroadipyl-CoA semialdehyde dehydrogenase (NADP+) (1.2.1.77)
2-formylbenzoate dehydrogenase (1.2.1.78)
succinate-semialdehyde dehydrogenase (NADP+) (1.2.1.79)
long-chain acyl-[acyl-carrier-protein] reductase (1.2.1.80)
sulfoacetaldehyde dehydrogenase (acylating) (1.2.1.81)
beta-apo-4'-carotenal oxygenase (1.2.1.82)
3-succinoylsemialdehyde-pyridine dehydrogenase (1.2.1.83)
alcohol-forming fatty acyl-CoA reductase (1.2.1.84)
2-hydroxymuconate-6-semialdehyde dehydrogenase (1.2.1.85)
geranial dehydrogenase (1.2.1.86)
propanal dehydrogenase (CoA-propanoylating) (1.2.1.87)
L-glutamate gamma-semialdehyde dehydrogenase (1.2.1.88)
D-glyceraldehyde dehydrogenase (NADP+) (1.2.1.89)
glyceraldehyde-3-phosphate dehydrogenase [NAD(P)+] (1.2.1.90)
3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase (1.2.1.91)
3,6-anhydro-alpha-L-galactose dehydrogenase (1.2.1.92)
formate dehydrogenase (NAD+, ferredoxin) (1.2.1.93)
farnesal dehydrogenase (1.2.1.94)
L-2-aminoadipate reductase (1.2.1.95)
4-hydroxybenzaldehyde dehydrogenase (NADP+) (1.2.1.96)
3-sulfolactaldehyde dehydrogenase (1.2.1.97)
2-hydroxy-2-methylpropanal dehydrogenase (1.2.1.98)
4-(gamma-glutamylamino)butanal dehydrogenase (1.2.1.99)
5-formyl-3-hydroxy-2-methylpyridine 4-carboxylic acid 5-dehydrogenase (1.2.1.100)
L-tyrosine reductase (1.2.1.101)
isopyridoxal dehydrogenase (5-pyridoxate-forming) (1.2.1.102)
[amino group carrier protein]-6-phospho-L-2-aminoadipate reductase (1.2.1.103)
pyruvate dehydrogenase system (1.2.1.104)
2-oxoglutarate dehydrogenase system (1.2.1.105)
[amino-group carrier protein]-5-phospho-L-glutamate reductase (1.2.1.106)
glyceraldehyde-3-phosphate dehydrogenase (arsenate-transferring) (1.2.1.107)
formate dehydrogenase (cytochrome) (1.2.2.1)
quinoprotein formaldehyde dehydrogenase (cytochrome b559/569) (1.2.2.B1)
pyruvate dehydrogenase (cytochrome) (1.2.2.2)
quinoprotein formaldehyde dehydrogenase (cytochrome cL) (1.2.2.B2)
formate dehydrogenase (cytochrome-c-553) (1.2.2.3)
carbon-monoxide dehydrogenase (cytochrome b-561) (1.2.2.4)
aldehyde oxidase (1.2.3.1)
xanthine oxidase (1.2.3.2)
pyruvate oxidase (1.2.3.3)
oxalate oxidase (1.2.3.4)
glyoxylate oxidase (1.2.3.5)
pyruvate oxidase (CoA-acetylating) (1.2.3.6)
indole-3-acetaldehyde oxidase (1.2.3.7)
pyridoxal oxidase (1.2.3.8)
aryl-aldehyde oxidase (1.2.3.9)
carbon-monoxide oxidase (1.2.3.10)
retinal oxidase (1.2.3.11)
vanillate demethylase (1.2.3.12)
4-hydroxyphenylpyruvate oxidase (1.2.3.13)
abscisic-aldehyde oxidase (1.2.3.14)
(methyl)glyoxal oxidase (1.2.3.15)
pyruvate dehydrogenase (acetyl-transferring) (1.2.4.1)
oxoglutarate dehydrogenase (succinyl-transferring) (1.2.4.2)
2-oxoisocaproate dehydrogenase (1.2.4.3)
3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring) (1.2.4.4)
pyruvate dehydrogenase (quinone) (1.2.5.1)
aldehyde dehydrogenase (quinone) (1.2.5.2)
aerobic carbon monoxide dehydrogenase (1.2.5.3)
pyruvate synthase (1.2.7.1)
2-oxobutyrate synthase (1.2.7.2)
formaldehyde ferredoxin oxidoreductase (1.2.7.B2)
2-oxoglutarate synthase (1.2.7.3)
aldehyde oxidoreductase WOR5 (1.2.7.B3)
anaerobic carbon-monoxide dehydrogenase (1.2.7.4)
aldehyde ferredoxin oxidoreductase (1.2.7.5)
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) (1.2.7.6)
3-methyl-2-oxobutanoate dehydrogenase (ferredoxin) (1.2.7.7)
indolepyruvate ferredoxin oxidoreductase (1.2.7.8)
2-oxoglutarate ferredoxin oxidoreductase (1.2.7.9)
oxalate oxidoreductase (1.2.7.10)
2-oxoacid oxidoreductase (ferredoxin) (1.2.7.11)
formylmethanofuran dehydrogenase (1.2.7.12)
formaldehyde dismutase (1.2.98.1)
uracil dehydrogenase (1.2.99.1)
carbon-monoxide dehydrogenase (acceptor) (1.2.99.2)
aldehyde dehydrogenase (pyrroloquinoline-quinone) (1.2.99.3)
formaldehyde dismutase (1.2.99.4)
formylmethanofuran dehydrogenase (1.2.99.5)
carboxylate reductase (1.2.99.6)
aldehyde dehydrogenase (FAD-independent) (1.2.99.7)
glyceraldehyde dehydrogenase (FAD-containing) (1.2.99.8)
formate dehydrogenase (coenzyme F420) (1.2.99.9)
4,4'-diapolycopenoate synthase (1.2.99.10)
dihydropyrimidine dehydrogenase (NAD+) (1.3.1.1)
dihydropyrimidine dehydrogenase (NADP+) (1.3.1.2)
DELTA4-3-oxosteroid 5beta-reductase (1.3.1.3)
cortisone alpha-reductase (1.3.1.4)
cucurbitacin DELTA23-reductase (1.3.1.5)
fumarate reductase (NADH) (1.3.1.6)
(3E)-3-[(4S)-4-hydroxycyclohex-2-en-1-yl]-2-oxopropanoate reductase [NAD(P)H] (1.3.1.B7)
meso-tartrate dehydrogenase (1.3.1.7)
acyl-CoA dehydrogenase (NADP+) (1.3.1.8)
enoyl-[acyl-carrier-protein] reductase (NADH) (1.3.1.9)
enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific) (1.3.1.10)
2-coumarate reductase (1.3.1.11)
prephenate dehydrogenase (1.3.1.12)
polyprenol reductase (NADPH) (1.3.1.B13)
prephenate dehydrogenase (NADP+) (1.3.1.13)
curacin A enoyl-acyl carrier protein reductase (1.3.1.B14)
dihydroorotate dehydrogenase (NAD+) (1.3.1.14)
dihydroorotate dehydrogenase (NADP+) (1.3.1.15)
beta-nitroacrylate reductase (1.3.1.16)
3-methyleneoxindole reductase (1.3.1.17)
kynurenate-7,8-dihydrodiol dehydrogenase (1.3.1.18)
cis-1,2-dihydrobenzene-1,2-diol dehydrogenase (1.3.1.19)
trans-1,2-dihydrobenzene-1,2-diol dehydrogenase (1.3.1.20)
7-dehydrocholesterol reductase (1.3.1.21)
3-oxo-5alpha-steroid 4-dehydrogenase (NADP+) (1.3.1.22)
cholestenone 5beta-reductase (1.3.1.23)
biliverdin reductase (1.3.1.24)
1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (1.3.1.25)
dihydrodipicolinate reductase (1.3.1.26)
2-hexadecenal reductase (1.3.1.27)
2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (1.3.1.28)
cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase (1.3.1.29)
progesterone 5alpha-reductase (1.3.1.30)
2-enoate reductase (1.3.1.31)
maleylacetate reductase (1.3.1.32)
protochlorophyllide reductase (1.3.1.33)
2,4-dienoyl-CoA reductase [(2E)-enoyl-CoA-producing] (1.3.1.34)
phosphatidylcholine desaturase (1.3.1.35)
geissoschizine dehydrogenase (1.3.1.36)
cis-2-enoyl-CoA reductase (NADPH) (1.3.1.37)
trans-2-enoyl-CoA reductase (NADPH) (1.3.1.38)
enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific) (1.3.1.39)
2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate reductase (1.3.1.40)
xanthommatin reductase (1.3.1.41)
12-oxophytodienoate reductase (1.3.1.42)
arogenate dehydrogenase (1.3.1.43)
trans-2-enoyl-CoA reductase (NAD+) (1.3.1.44)
2'-hydroxyisoflavone reductase (1.3.1.45)
biochanin-A reductase (1.3.1.46)
alpha-santonin 1,2-reductase (1.3.1.47)
13,14-dehydro-15-oxoprostaglandin 13-reductase (1.3.1.48)
cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase (1.3.1.49)
tetrahydroxynaphthalene reductase (1.3.1.50)
2'-hydroxydaidzein reductase (1.3.1.51)
2-methyl-branched-chain-enoyl-CoA reductase (1.3.1.52)
(3S,4R)-3,4-dihydroxycyclohexa-1,5-diene-1,4-dicarboxylate dehydrogenase (1.3.1.53)
precorrin-6A reductase (1.3.1.54)
cis-1,2-dihydroxycyclohexa-3,5-diene-1-carboxylate dehydrogenase (1.3.1.55)
cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (1.3.1.56)
phloroglucinol reductase (1.3.1.57)
2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase (1.3.1.58)
1,2-dihydroxy-3-methyl-1,2-dihydrobenzoate dehydrogenase (1.3.1.59)
dibenzothiophene dihydrodiol dehydrogenase (1.3.1.60)
terephthalate 1,2-cis-dihydrodiol dehydrogenase (1.3.1.61)
pimeloyl-CoA dehydrogenase (1.3.1.62)
2,4-dichlorobenzoyl-CoA reductase (1.3.1.63)
phthalate 4,5-cis-dihydrodiol dehydrogenase (1.3.1.64)
5,6-dihydroxy-3-methyl-2-oxo-1,2,5,6-tetrahydroquinoline dehydrogenase (1.3.1.65)
cis-dihydroethylcatechol dehydrogenase (1.3.1.66)
cis-1,2-dihydroxy-4-methylcyclohexa-3,5-diene-1-carboxylate dehydrogenase (1.3.1.67)
1,2-dihydroxy-6-methylcyclohexa-3,5-dienecarboxylate dehydrogenase (1.3.1.68)
zeatin reductase (1.3.1.69)
DELTA14-sterol reductase (1.3.1.70)
DELTA24(241)-sterol reductase (1.3.1.71)
DELTA24-sterol reductase (1.3.1.72)
1,2-dihydrovomilenine reductase (1.3.1.73)
2-alkenal reductase [NAD(P)+] (1.3.1.74)
3,8-divinyl protochlorophyllide a 8-vinyl-reductase (NADPH) (1.3.1.75)
precorrin-2 dehydrogenase (1.3.1.76)
anthocyanidin reductase [(2R,3R)-flavan-3-ol-forming] (1.3.1.77)
arogenate dehydrogenase (NADP+) (1.3.1.78)
arogenate dehydrogenase [NAD(P)+] (1.3.1.79)
red chlorophyll catabolite reductase (1.3.1.80)
(+)-pulegone reductase (1.3.1.81)
(-)-isopiperitenone reductase (1.3.1.82)
geranylgeranyl diphosphate reductase (1.3.1.83)
acrylyl-CoA reductase (NADPH) (1.3.1.84)
crotonyl-CoA carboxylase/reductase (1.3.1.85)
crotonyl-CoA reductase (1.3.1.86)
3-(cis-5,6-dihydroxycyclohexa-1,3-dien-1-yl)propanoate dehydrogenase (1.3.1.87)
tRNA-dihydrouridine16/17 synthase [NAD(P)+] (1.3.1.88)
tRNA-dihydrouridine47 synthase [NAD(P)+] (1.3.1.89)
tRNA-dihydrouridine20a/20b synthase [NAD(P)+] (1.3.1.90)
tRNA-dihydrouridine20 synthase [NAD(P)+] (1.3.1.91)
artemisinic aldehyde DELTA11(13)-reductase (1.3.1.92)
very-long-chain enoyl-CoA reductase (1.3.1.93)
polyprenol reductase (1.3.1.94)
acrylyl-CoA reductase (NADH) (1.3.1.95)
Botryococcus squalene synthase (1.3.1.96)
botryococcene synthase (1.3.1.97)
UDP-N-acetylmuramate dehydrogenase (1.3.1.98)
iridoid synthase (1.3.1.99)
chanoclavine-I aldehyde reductase (1.3.1.100)
2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H] (1.3.1.101)
2-alkenal reductase (NADP+) (1.3.1.102)
2-haloacrylate reductase (1.3.1.103)
enoyl-[acyl-carrier-protein] reductase (NADPH) (1.3.1.104)
2-methylene-furan-3-one reductase (1.3.1.105)
cobalt-precorrin-6A reductase (1.3.1.106)
sanguinarine reductase (1.3.1.107)
caffeoyl-CoA reductase (1.3.1.108)
butanoyl-CoA dehydrogenase complex (NAD+, ferredoxin) (1.3.1.109)
lactate dehydrogenase (NAD+, ferredoxin) (1.3.1.110)
geranylgeranyl-bacteriochlorophyllide a reductase (1.3.1.111)
anthocyanidin reductase [(2S)-flavan-3-ol-forming] (1.3.1.112)
(4-alkanoyl-5-oxo-2,5-dihydrofuran-3-yl)methyl phosphate reductase (1.3.1.113)
3-dehydro-bile acid DELTA4,6-reductase (1.3.1.114)
3-oxocholoyl-CoA 4-desaturase (1.3.1.115)
7beta-hydroxy-3-oxochol-24-oyl-CoA 4-desaturase (1.3.1.116)
hydroxycinnamoyl-CoA reductase (1.3.1.117)
meromycolic acid enoyl-[acyl-carrier-protein] reductase (1.3.1.118)
chlorobenzene dihydrodiol dehydrogenase (1.3.1.119)
cyclohexane-1-carbonyl-CoA reductase (NADP+) (1.3.1.120)
4-amino-4-deoxyprephenate dehydrogenase (1.3.1.121)
(S)-8-oxocitronellyl enol synthase (1.3.1.122)
8-oxogeranial reductase (1.3.1.123)
2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (1.3.1.124)
butyryl-CoA dehydrogenase (1.3.2.1)
acyl-CoA dehydrogenase (1.3.2.2)
L-galactonolactone dehydrogenase (1.3.2.3)
dihydroorotate oxidase (1.3.3.1)
lathosterol oxidase (1.3.3.2)
coproporphyrinogen oxidase (1.3.3.3)
protoporphyrinogen oxidase (1.3.3.4)
bilirubin oxidase (1.3.3.5)
acyl-CoA oxidase (1.3.3.6)
dihydrouracil oxidase (1.3.3.7)
tetrahydroberberine oxidase (1.3.3.8)
secologanin synthase (1.3.3.9)
tryptophan alpha,beta-oxidase (1.3.3.10)
pyrroloquinoline-quinone synthase (1.3.3.11)
L-galactonolactone oxidase (1.3.3.12)
albonoursin synthase (1.3.3.13)
aclacinomycin-A oxidase (1.3.3.14)
coproporphyrinogen III oxidase (coproporphyrin-forming) (1.3.3.15)
oxazoline dehydrogenase (1.3.3.16)
benzylmalonyl-CoA dehydrogenase (1.3.3.17)
fumarate reductase (CoM/CoB) (1.3.4.1)
succinate dehydrogenase (1.3.5.1)
dihydroorotate dehydrogenase (quinone) (1.3.5.2)
protoporphyrinogen IX dehydrogenase (quinone) (1.3.5.3)
beta-carotene monoketolase (1.3.5.B4)
fumarate reductase (quinol) (1.3.5.4)
15-cis-phytoene desaturase (1.3.5.5)
9,9'-dicis-zeta-carotene desaturase (1.3.5.6)
6-hydroxynicotinate reductase (1.3.7.1)
15,16-dihydrobiliverdin:ferredoxin oxidoreductase (1.3.7.2)
phycoerythrobilin:ferredoxin oxidoreductase (1.3.7.3)
phytochromobilin:ferredoxin oxidoreductase (1.3.7.4)
phycocyanobilin:ferredoxin oxidoreductase (1.3.7.5)
phycoerythrobilin synthase (1.3.7.6)
ferredoxin:protochlorophyllide reductase (ATP-dependent) (1.3.7.7)
benzoyl-CoA reductase (1.3.7.8)
4-hydroxybenzoyl-CoA reductase (1.3.7.9)
pentalenolactone synthase (1.3.7.10)
2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase (1.3.7.11)
red chlorophyll catabolite reductase (1.3.7.12)
3,8-divinyl protochlorophyllide a 8-vinyl-reductase (ferredoxin) (1.3.7.13)
3,8-divinyl chlorophyllide a reductase (1.3.7.14)
chlorophyllide a reductase (1.3.7.15)
short-chain acyl-CoA dehydrogenase (1.3.8.1)
4,4'-diapophytoene desaturase (4,4'-diapolycopene-forming) (1.3.8.2)
(R)-benzylsuccinyl-CoA dehydrogenase (1.3.8.3)
isovaleryl-CoA dehydrogenase (1.3.8.4)
short-chain 2-methylacyl-CoA dehydrogenase (1.3.8.5)
glutaryl-CoA dehydrogenase (ETF) (1.3.8.6)
medium-chain acyl-CoA dehydrogenase (1.3.8.7)
long-chain acyl-CoA dehydrogenase (1.3.8.8)
very-long-chain acyl-CoA dehydrogenase (1.3.8.9)
cyclohex-1-ene-1-carbonyl-CoA dehydrogenase (1.3.8.10)
cyclohexane-1-carbonyl-CoA dehydrogenase (electron-transfer flavoprotein) (1.3.8.11)
(2S)-methylsuccinyl-CoA dehydrogenase (1.3.8.12)
crotonobetainyl-CoA reductase (1.3.8.13)
L-prolyl-[peptidyl-carrier protein] dehydrogenase (1.3.8.14)
3-(aryl)acrylate reductase (1.3.8.15)
2-amino-4-deoxychorismate dehydrogenase (1.3.8.16)
dehydro coenzyme F420 reductase (1.3.8.17)
dihydroorotate dehydrogenase (fumarate) (1.3.98.1)
umarate reductase (CoM/CoB) (1.3.98.2)
coproporphyrinogen dehydrogenase (1.3.98.3)
5a,11a-dehydrotetracycline reductase (1.3.98.4)
hydrogen peroxide-dependent heme synthase (1.3.98.5)
AdoMet-dependent heme synthase (1.3.98.6)
[mycofactocin precursor peptide]-tyrosine decarboxylase (1.3.98.7)
succinate dehydrogenase (1.3.99.1)
butyryl-CoA dehydrogenase (1.3.99.2)
citronellyl-CoA dehydrogenase (1.3.99.B2)
acyl-CoA dehydrogenase (1.3.99.3)
3-oxosteroid 1-dehydrogenase (1.3.99.4)
3-oxo-5alpha-steroid 4-dehydrogenase (acceptor) (1.3.99.5)
3-oxo-5beta-steroid 4-dehydrogenase (1.3.99.6)
glutaryl-CoA dehydrogenase (1.3.99.7)
2-furoyl-CoA dehydrogenase (1.3.99.8)
beta-cyclopiazonate dehydrogenase (1.3.99.9)
isovaleryl-CoA dehydrogenase (1.3.99.10)
dihydroorotate dehydrogenase (1.3.99.11)
2-methylacyl-CoA dehydrogenase (1.3.99.12)
menaquinone-7 reductase (acceptor) (1.3.99.B12)
3-(methylthio)propionyl-CoA dehydrogenase (1.3.99.B13)
long-chain-acyl-CoA dehydrogenase (1.3.99.13)
cyclohexanone dehydrogenase (1.3.99.14)
benzoyl-CoA reductase (1.3.99.15)
dolichyl phosphate omega-isoprene reductase (1.3.99.B15)
3-phenylpropionyl-CoA dehydrogenase (1.3.99.B16)
Isoquinoline 1-oxidoreductase (1.3.99.16)
quinoline 2-oxidoreductase (1.3.99.17)
quinaldate 4-oxidoreductase (1.3.99.18)
quinoline-4-carboxylate 2-oxidoreductase (1.3.99.19)
4-hydroxybenzoyl-CoA reductase (1.3.99.20)
(R)-benzylsuccinyl-CoA dehydrogenase (1.3.99.21)
coproporphyrinogen dehydrogenase (1.3.99.22)
all-trans-retinol 13,14-reductase (1.3.99.23)
2-amino-4-deoxychorismate dehydrogenase (1.3.99.24)
carvone reductase (1.3.99.25)
all-trans-zeta-carotene desaturase (1.3.99.26)
1-hydroxycarotenoid 3,4-desaturase (1.3.99.27)
phytoene desaturase (neurosporene-forming) (1.3.99.28)
phytoene desaturase (zeta-carotene-forming) (1.3.99.29)
phytoene desaturase (3,4-didehydrolycopene-forming) (1.3.99.30)
phytoene desaturase (lycopene-forming) (1.3.99.31)
glutaryl-CoA dehydrogenase (acceptor) (1.3.99.32)
urocanate reductase (1.3.99.33)
2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase (donor) (1.3.99.34)
chlorophyllide a reductase (1.3.99.35)
cypemycin cysteine dehydrogenase (decarboxylating) (1.3.99.36)
1-hydroxy-2-isopentenylcarotenoid 3,4-desaturase (1.3.99.37)
menaquinone-9 beta-reductase (1.3.99.38)
carotenoid phi-ring synthase (1.3.99.39)
carotenoid chi-ring synthase (1.3.99.40)
3-(methylsulfanyl)propanoyl-CoA 2-dehydrogenase (1.3.99.41)
alanine dehydrogenase (1.4.1.1)
glutamate dehydrogenase (1.4.1.2)
L-erythro-3,5-diaminohexanoate dehydrogenase (NADP+) (1.4.1.B2)
glutamate dehydrogenase [NAD(P)+] (1.4.1.3)
carboxynorspermidine dehydrogenase (1.4.1.B4)
glutamate dehydrogenase (NADP+) (1.4.1.4)
glutamate synthase (NAD(P)H) (1.4.1.B5)
L-amino-acid dehydrogenase (1.4.1.5)
D-proline reductase (1.4.1.6)
secondary amine dehydrogenase (1.4.1.B6)
serine 2-dehydrogenase (1.4.1.7)
valine dehydrogenase (NADP+) (1.4.1.8)
leucine dehydrogenase (1.4.1.9)
glycine dehydrogenase (1.4.1.10)
L-erythro-3,5-diaminohexanoate dehydrogenase (1.4.1.11)
2,4-diaminopentanoate dehydrogenase (1.4.1.12)
glutamate synthase (NADPH) (1.4.1.13)
glutamate synthase (NADH) (1.4.1.14)
lysine dehydrogenase (1.4.1.15)
diaminopimelate dehydrogenase (1.4.1.16)
N-methylalanine dehydrogenase (1.4.1.17)
lysine 6-dehydrogenase (1.4.1.18)
tryptophan dehydrogenase (1.4.1.19)
phenylalanine dehydrogenase (1.4.1.20)
aspartate dehydrogenase (1.4.1.21)
valine dehydrogenase (NAD+) (1.4.1.23)
3-dehydroquinate synthase II (1.4.1.24)
L-arginine dehydrogenase (1.4.1.25)
2,4-diaminopentanoate dehydrogenase (NAD+) (1.4.1.26)
glycine cleavage system (1.4.1.27)
secondary-alkyl amine dehydrogenase [NAD(P)+] (1.4.1.28)
D-alanine dehydrogenase (cytochrome) (1.4.2.B1)
glycine dehydrogenase (cytochrome) (1.4.2.1)
D-aspartate oxidase (1.4.3.1)
gamma-glutamylputrescine oxidase (1.4.3.B1)
L-amino-acid oxidase (1.4.3.2)
D-amino-acid oxidase (1.4.3.3)
monoamine oxidase (1.4.3.4)
pyridoxal 5'-phosphate synthase (1.4.3.5)
amine oxidase (copper-containing) (1.4.3.6)
D-glutamate oxidase (1.4.3.7)
ethanolamine oxidase (1.4.3.8)
tyramine oxidase (1.4.3.9)
putrescine oxidase (1.4.3.10)
L-glutamate oxidase (1.4.3.11)
cyclohexylamine oxidase (1.4.3.12)
protein-lysine 6-oxidase (1.4.3.13)
L-lysine oxidase (1.4.3.14)
D-glutamate(D-aspartate) oxidase (1.4.3.15)
L-aspartate oxidase (1.4.3.16)
tryptophan alpha,beta-oxidase (1.4.3.17)
cytokinin oxidase (1.4.3.18)
glycine oxidase (1.4.3.19)
L-lysine 6-oxidase (1.4.3.20)
primary-amine oxidase (1.4.3.21)
diamine oxidase (1.4.3.22)
7-chloro-L-tryptophan oxidase (1.4.3.23)
pseudooxynicotine oxidase (1.4.3.24)
L-arginine oxidase (1.4.3.25)
pre-mycofactocin synthase (1.4.3.26)
D-proline reductase (dithiol) (1.4.4.1)
glycine dehydrogenase (aminomethyl-transferring) (1.4.4.2)
D-amino acid dehydrogenase (quinone) (1.4.5.1)
glutamate synthase (ferredoxin) (1.4.7.1)
methylamine dehydrogenase (amicyanin) (1.4.9.1)
aralkylamine dehydrogenase (azurin) (1.4.9.2)
amine dehydrogenase (amicyanin) (1.4.98.1)
D-amino-acid dehydrogenase (1.4.99.1)
taurine dehydrogenase (1.4.99.2)
amine dehydrogenase (1.4.99.3)
L-amino acid dehydrogenase (cytochrome b) (1.4.99.B3)
aralkylamine dehydrogenase (1.4.99.4)
cis-4-hydroxy-D-proline dehydrogenase (1.4.99.B4)
glycine dehydrogenase (cyanide-forming) (1.4.99.5)
D-arginine dehydrogenase (1.4.99.6)
1-piperideine-2-carboxylate/1-pyrroline-2-carboxylate reductase [NAD(P)H] (1.5.1.1)
pyrroline-5-carboxylate reductase (1.5.1.2)
dihydrofolate reductase (1.5.1.3)
dihydrofolate dehydrogenase (1.5.1.4)
DELTA1-piperideine-2-carboxylate/DELTA1-pyrroline-2-carboxylate reductase (NADH) (1.5.1.B5)
methylenetetrahydrofolate dehydrogenase (NADP+) (1.5.1.5)
formyltetrahydrofolate dehydrogenase (1.5.1.6)
pseudopaline synthase (1.5.1.B7)
saccharopine dehydrogenase (NAD+, L-lysine-forming) (1.5.1.7)
saccharopine dehydrogenase (NADP+, L-lysine-forming) (1.5.1.8)
yersinopine synthase (1.5.1.B8)
saccharopine dehydrogenase (NAD+, L-glutamate-forming) (1.5.1.9)
saccharopine dehydrogenase (NADP+, L-glutamate-forming) (1.5.1.10)
D-octopine dehydrogenase (1.5.1.11)
1-pyrroline-5-carboxylate dehydrogenase (1.5.1.12)
nicotinate dehydrogenase (1.5.1.13)
1,2-didehydropipecolate reductase (1.5.1.14)
methylenetetrahydrofolate dehydrogenase (NAD+) (1.5.1.15)
D-lysopine dehydrogenase (1.5.1.16)
alanopine dehydrogenase (1.5.1.17)
ephedrine dehydrogenase (1.5.1.18)
D-nopaline dehydrogenase (1.5.1.19)
methylenetetrahydrofolate reductase [NAD(P)H] (1.5.1.20)
1-piperideine-2-carboxylate/1-pyrroline-2-carboxylate reductase (NADPH) (1.5.1.21)
Strombine dehydrogenase (1.5.1.22)
Tauropine dehydrogenase (1.5.1.23)
N5-(carboxyethyl)ornithine synthase (1.5.1.24)
thiomorpholine-carboxylate dehydrogenase (1.5.1.25)
beta-alanopine dehydrogenase (1.5.1.26)
1,2-dehydroreticulinium reductase (NADPH) (1.5.1.27)
Opine dehydrogenase (1.5.1.28)
FMN reductase (1.5.1.29)
flavin reductase (NADPH) (1.5.1.30)
berberine reductase (1.5.1.31)
vomilenine reductase (1.5.1.32)
pteridine reductase (1.5.1.33)
6,7-dihydropteridine reductase (1.5.1.34)
1-pyrroline dehydrogenase (1.5.1.35)
flavin reductase (NADH) (1.5.1.36)
FAD reductase (NADH) (1.5.1.37)
FMN reductase (NADPH) (1.5.1.38)
FMN reductase [NAD(P)H] (1.5.1.39)
8-hydroxy-5-deazaflavin:NADPH oxidoreductase (1.5.1.40)
riboflavin reductase [NAD(P)H] (1.5.1.41)
FMN reductase (NADH) (1.5.1.42)
carboxynorspermidine synthase (1.5.1.43)
festuclavine dehydrogenase (1.5.1.44)
FAD reductase [NAD(P)H] (1.5.1.45)
agroclavine dehydrogenase (1.5.1.46)
dihydromethanopterin reductase [NAD(P)+] (1.5.1.47)
2-methyl-1-pyrroline reductase (1.5.1.48)
1-pyrroline-2-carboxylate reductase [NAD(P)H] (1.5.1.49)
dihydromonapterin reductase (1.5.1.50)
N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase (1.5.1.51)
staphylopine dehydrogenase (1.5.1.52)
methylenetetrahydrofolate reductase (NADPH) (1.5.1.53)
methylenetetrahydrofolate reductase (NADH) (1.5.1.54)
sarcosine oxidase (formaldehyde-forming) (1.5.3.1)
N-methyl-L-amino-acid oxidase (1.5.3.2)
spermine oxidase (1.5.3.3)
N6-methyl-lysine oxidase (1.5.3.4)
(S)-6-hydroxynicotine oxidase (1.5.3.5)
(R)-6-hydroxynicotine oxidase (1.5.3.6)
L-pipecolate oxidase (1.5.3.7)
(S)-tetrahydroprotoberberine oxidase (1.5.3.8)
reticuline oxidase (1.5.3.9)
dimethylglycine oxidase (1.5.3.10)
polyamine oxidase (1.5.3.11)
dihydrobenzophenanthridine oxidase (1.5.3.12)
N1-acetylpolyamine oxidase (1.5.3.13)
polyamine oxidase (propane-1,3-diamine-forming) (1.5.3.14)
N8-acetylspermidine oxidase (propane-1,3-diamine-forming) (1.5.3.15)
spermine oxidase (1.5.3.16)
non-specific polyamine oxidase (1.5.3.17)
L-saccharopine oxidase (1.5.3.18)
4-methylaminobutanoate oxidase (formaldehyde-forming) (1.5.3.19)
N-alkylglycine oxidase (1.5.3.20)
4-methylaminobutanoate oxidase (methylamine-forming) (1.5.3.21)
coenzyme F420H2 oxidase (1.5.3.22)
glyphosate oxidoreductase (1.5.3.23)
sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) (1.5.3.24)
fructosyl amine oxidase (glucosone-forming) (1.5.3.25)
fructosyl amine oxidase (fructosamine-forming) (1.5.3.26)
pyrimidodiazepine synthase (1.5.4.1)
electron-transferring-flavoprotein dehydrogenase (1.5.5.1)
proline dehydrogenase (1.5.5.2)
hydroxyproline dehydrogenase (1.5.5.3)
methylenetetrahydrofolate reductase (ferredoxin) (1.5.7.1)
coenzyme F420 oxidoreductase (ferredoxin) (1.5.7.2)
N,N-dimethylglycine/sarcosine dehydrogenase (ferredoxin) (1.5.7.3)
dimethylamine dehydrogenase (1.5.8.1)
trimethylamine dehydrogenase (1.5.8.2)
sarcosine dehydrogenase (1.5.8.3)
dimethylglycine dehydrogenase (1.5.8.4)
methylenetetrahydromethanopterin dehydrogenase (1.5.98.1)
5,10-methylenetetrahydromethanopterin reductase (1.5.98.2)
coenzyme F420:methanophenazine dehydrogenase (1.5.98.3)
sarcosine dehydrogenase (1.5.99.1)
dimethylglycine dehydrogenase (1.5.99.2)
proline dehydrogenase (acceptor) (1.5.99.B2)
L-pipecolate dehydrogenase (1.5.99.3)
flavin-containing opine dehydrogenase (1.5.99.B4)
nicotine dehydrogenase (1.5.99.4)
methylglutamate dehydrogenase (1.5.99.5)
spermidine dehydrogenase (1.5.99.6)
trimethylamine dehydrogenase (1.5.99.7)
proline dehydrogenase (1.5.99.8)
methylenetetrahydromethanopterin dehydrogenase (1.5.99.9)
dimethylamine dehydrogenase (1.5.99.10)
5,10-methylenetetrahydromethanopterin reductase (1.5.99.11)
cytokinin dehydrogenase (1.5.99.12)
D-proline dehydrogenase (1.5.99.13)
6-hydroxypseudooxynicotine dehydrogenase (1.5.99.14)
dihydromethanopterin reductase (acceptor) (1.5.99.15)
NAD(P)+ transhydrogenase (Si-specific) (1.6.1.1)
NAD(P)+ transhydrogenase (Re/Si-specific) (1.6.1.2)
NAD(P)+ transhydrogenase (1.6.1.3)
NAD(P)+ transhydrogenase (ferredoxin) (1.6.1.4)
proton-translocating NAD(P)+ transhydrogenase (1.6.1.5)
NADH2 cytochrome c reductase (1.6.2.1)
cytochrome-b5 reductase (1.6.2.2)
cytochrome reductase (NADPH) (1.6.2.3)
NADPH-hemoprotein reductase (1.6.2.4)
NADPH-cytochrome-c2 reductase (1.6.2.5)
leghemoglobin reductase (1.6.2.6)
NAD(P)H oxidase (H2O2-forming) (1.6.3.1)
NAD(P)H oxidase (H2O-forming) (1.6.3.2)
NADH oxidase (H2O2-forming) (1.6.3.3)
NADH oxidase (H2O-forming) (1.6.3.4)
renalase (1.6.3.5)
cystine reductase (NADH) (1.6.4.1)
glutathione reductase (NADPH) (1.6.4.2)
dihydrolipoamide reductase (NAD+) (1.6.4.3)
protein-disulfide reductase [NAD(P)H] (1.6.4.4)
thioredoxin reductase (NADPH) (1.6.4.5)
CoA-glutathione reductase (NADPH) (1.6.4.6)
asparagusate reductase (NADH) (1.6.4.7)
trypanothione reductase (1.6.4.8)
bis-gamma-glutamylcystine reductase (NADPH) (1.6.4.9)
CoA-disulfide reductase (NADH) (1.6.4.10)
quinone reductase (1.6.5.1)
NAD(P)H dehydrogenase (quinone) (1.6.5.2)
NADH:ubiquinone reductase (H+-translocating) (1.6.5.3)
monodehydroascorbate reductase (NADH) (1.6.5.4)
NADPH:quinone reductase (1.6.5.5)
p-benzoquinone reductase (NADPH) (1.6.5.6)
2-hydroxy-1,4-benzoquinone reductase (1.6.5.7)
NADH:ubiquinone reductase (Na+-transporting) (1.6.5.8)
NADH:quinone reductase (non-electrogenic) (1.6.5.9)
NADPH dehydrogenase (quinone) (1.6.5.10)
NADH dehydrogenase (quinone) (1.6.5.11)
demethylphylloquinone reductase (1.6.5.12)
nitrate reductase (NADH) (1.6.6.1)
nitrate reductase [NAD(P)H] (1.6.6.2)
nitrate reductase (NADPH) (1.6.6.3)
nitrite reductase [NAD(P)H] (1.6.6.4)
Recommended Name never specified (1.6.6.5)
hyponitrite reductase (1.6.6.6)
azobenzene reductase (1.6.6.7)
GMP reductase (1.6.6.8)
trimethylamine-N-oxide reductase (1.6.6.9)
nitroquinoline-N-oxide reductase (1.6.6.10)
hydroxylamine reductase (NADH) (1.6.6.11)
4-(dimethylamino)phenylazoxybenzene reductase (1.6.6.12)
N-hydroxy-2-acetamidofluorene reductase (1.6.6.13)
ferredoxin-NADP+ reductase (1.6.7.1)
rubredoxin-NAD+ reductase (1.6.7.2)
NAD(P)H dehydrogenase (FMN) (1.6.8.1)
NADPH dehydrogenase (flavin) (1.6.8.2)
NADPH dehydrogenase (1.6.99.1)
NAD(P)H dehydrogenase (quinone) (1.6.99.2)
NADH dehydrogenase (1.6.99.3)
nitrite reductase (1.6.99.4)
NADH dehydrogenase (quinone) (1.6.99.5)
NADPH dehydrogenase (quinone) (1.6.99.6)
dihydropteridine reductase (1.6.99.7)
aquacobalamin reductase (1.6.99.8)
cob(II)alamin reductase (1.6.99.9)
dihydropteridine reductase (NADH) (1.6.99.10)
aquacobalamin reductase (NADPH) (1.6.99.11)
cyanocobalamin reductase (NADPH, cyanide-eliminating) (1.6.99.12)
ferric-chelate reductase (1.6.99.13)
nitrate reductase (NADH) (1.7.1.1)
xenobiotic reductase B (1.7.1.B1)
aromatic nitroreductase [NAD(P)H] (1.7.1.B2)
Nitrate reductase [NAD(P)H] (1.7.1.2)
aromatic nitroreductase [NADPH] (1.7.1.B3)
nitrate reductase (NADPH) (1.7.1.3)
azobenzene reductase [NADH] (1.7.1.B4)
nitrite reductase [NAD(P)H] (1.7.1.4)
hyponitrite reductase (1.7.1.5)
azobenzene reductase (1.7.1.6)
GMP reductase (1.7.1.7)
Recommended Name never specified (1.7.1.8)
nitroquinoline-N-oxide reductase (1.7.1.9)
hydroxylamine reductase (NADH) (1.7.1.10)
4-(dimethylamino)phenylazoxybenzene reductase (1.7.1.11)
N-hydroxy-2-acetamidofluorene reductase (1.7.1.12)
preQ1 synthase (1.7.1.13)
nitric oxide reductase [NAD(P)+, nitrous oxide-forming] (1.7.1.14)
nitrite reductase (NADH) (1.7.1.15)
nitrobenzene nitroreductase (1.7.1.16)
FMN-dependent NADH-azoreductase (1.7.1.17)
nitrite reductase (NO-forming) (1.7.2.1)
nitrite reductase (cytochrome; ammonia-forming) (1.7.2.2)
trimethylamine-N-oxide reductase (1.7.2.3)
nitrous-oxide reductase (1.7.2.4)
nitric oxide reductase (cytochrome c) (1.7.2.5)
hydroxylamine dehydrogenase (1.7.2.6)
hydrazine synthase (1.7.2.7)
hydrazine dehydrogenase (1.7.2.8)
hydroxylamine oxidase (1.7.2.9)
nitroalkane oxidase (1.7.3.1)
acetylindoxyl oxidase (1.7.3.2)
factor-independent urate hydroxylase (1.7.3.3)
hydroxylamine oxidase (1.7.3.4)
3-aci-nitropropanoate oxidase (1.7.3.5)
hydroxylamine oxidase (cytochrome) (1.7.3.6)
nitrate reductase (quinone) (1.7.5.1)
nitric oxide reductase (menaquinol) (1.7.5.2)
nitrite dismutase (1.7.6.1)
ferredoxin-nitrite reductase (1.7.7.1)
ferredoxin-nitrate reductase (1.7.7.2)
hydroxylamine reductase (1.7.99.1)
nitric-oxide reductase (1.7.99.2)
nitrite reductase (1.7.99.3)
nitrate reductase (1.7.99.4)
5,10-methylenetetrahydrofolate reductase (FADH2) (1.7.99.5)
nitrous-oxide reductase (1.7.99.6)
nitric-oxide reductase (1.7.99.7)
hydrazine oxidoreductase (1.7.99.8)
cysteamine dehydrogenase (1.8.1.1)
thioredoxin glutathione reductase (1.8.1.B1)
assimilatory sulfite reductase (NADPH) (1.8.1.2)
hypotaurine dehydrogenase (1.8.1.3)
dihydrolipoyl dehydrogenase (1.8.1.4)
[protein disulfide oxidoreductase]-disulfide oxidoreductase (1.8.1.B4)
2-oxopropyl-CoM reductase (carboxylating) (1.8.1.5)
protein-disulfide reductase (CoM-dependent) (1.8.1.B5)
cystine reductase (1.8.1.6)
glutathione-disulfide reductase (1.8.1.7)
protein-disulfide reductase (1.8.1.8)
thioredoxin-disulfide reductase (1.8.1.9)
CoA-glutathione reductase (1.8.1.10)
asparagusate reductase (1.8.1.11)
trypanothione-disulfide reductase (1.8.1.12)
bis-gamma-glutamylcystine reductase (1.8.1.13)
CoA-disulfide reductase (1.8.1.14)
mycothione reductase (1.8.1.15)
glutathione amide reductase (1.8.1.16)
dimethylsulfone reductase (1.8.1.17)
NAD(P)H sulfur oxidoreductase (CoA-dependent) (1.8.1.18)
sulfide dehydrogenase (1.8.1.19)
4,4'-dithiodibutanoate disulfide reductase (1.8.1.20)
dissimilatory dimethyldisulfide reductase (1.8.1.21)
sulfite dehydrogenase (cytochrome) (1.8.2.1)
thiosulfate dehydrogenase (1.8.2.2)
sulfide-cytochrome-c reductase (flavocytochrome c) (1.8.2.3)
dimethyl sulfide:cytochrome c2 reductase (1.8.2.4)
thiosulfate reductase (cytochrome) (1.8.2.5)
S-disulfanyl-L-cysteine oxidoreductase (1.8.2.6)
thiocyanate desulfurase (1.8.2.7)
sulfite oxidase (1.8.3.1)
formylglycine generating enzyme (1.8.3.B2)
thiol oxidase (1.8.3.2)
glutathione oxidase (1.8.3.3)
methanethiol oxidase (1.8.3.4)
prenylcysteine oxidase (1.8.3.5)
farnesylcysteine lyase (1.8.3.6)
formylglycine-generating enzyme (1.8.3.7)
glutathione-homocystine transhydrogenase (1.8.4.1)
protein-disulfide reductase (glutathione) (1.8.4.2)
glutathione-CoA-glutathione transhydrogenase (1.8.4.3)
thioredoxin-independent methionine sulfoxide reductases B (1.8.4.B3)
glutathione-cystine transhydrogenase (1.8.4.4)
methionine-S-oxide reductase (1.8.4.5)
protein-methionine-S-oxide reductase (1.8.4.6)
enzyme-thiol transhydrogenase (glutathione-disulfide) (1.8.4.7)
phosphoadenylyl-sulfate reductase (thioredoxin) (1.8.4.8)
adenylyl-sulfate reductase (glutathione) (1.8.4.9)
adenylyl-sulfate reductase (thioredoxin) (1.8.4.10)
peptide-methionine (S)-S-oxide reductase (1.8.4.11)
peptide-methionine (R)-S-oxide reductase (1.8.4.12)
L-methionine (S)-S-oxide reductase (1.8.4.13)
L-methionine (R)-S-oxide reductase (1.8.4.14)
protein dithiol oxidoreductase (disulfide-forming) (1.8.4.15)
thioredoxin:protein disulfide reductase (1.8.4.16)
glutathione dehydrogenase (ascorbate) (1.8.5.1)
peptide-methionine (S)-S-oxide reductase (quinone) (1.8.5.B1)
thiosulfate dehydrogenase (quinone) (1.8.5.2)
respiratory dimethylsulfoxide reductase (1.8.5.3)
bacterial sulfide:quinone reductase (1.8.5.4)
thiosulfate reductase (quinone) (1.8.5.5)
sulfite dehydrogenase (quinone) (1.8.5.6)
glutathionyl-hydroquinone reductase (1.8.5.7)
eukaryotic sulfide quinone oxidoreductase (1.8.5.8)
protein dithiol:quinone oxidoreductase DsbB (1.8.5.9)
nitrate-ester reductase (1.8.6.1)
assimilatory sulfite reductase (ferredoxin) (1.8.7.1)
ferredoxin:thioredoxin reductase (1.8.7.2)
ferredoxin:CoB-CoM heterodisulfide reductase (1.8.7.3)
dihydromethanophenazine:CoB-CoM heterodisulfide reductase (1.8.98.1)
sulfiredoxin (1.8.98.2)
sulfite reductase (coenzyme F420) (1.8.98.3)
coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase (1.8.98.4)
H2:CoB-CoM heterodisulfide,ferredoxin reductase (1.8.98.5)
formate:CoB-CoM heterodisulfide,ferredoxin reductase (1.8.98.6)
cysteine-type anaerobic sulfatase-maturating enzyme (1.8.98.7)
protein-disulfide reductase (acceptor) (1.8.99.B1)
sulfite reductase (1.8.99.1)
adenylyl-sulfate reductase (1.8.99.2)
tetrathionate reductase (1.8.99.B2)
hydrogensulfite reductase (1.8.99.3)
phosphoadenosine-phosphosulfate reductase (1.8.99.4)
dissimilatory sulfite reductase (1.8.99.5)
cytochrome-c oxidase (1.9.3.1)
Pseudomonas cytochrome oxidase (1.9.3.2)
nitrate reductase (cytochrome) (1.9.6.1)
iron-cytochrome-c reductase (1.9.98.1)
iron-cytochrome-c reductase (1.9.99.1)
trans-acenaphthene-1,2-diol dehydrogenase (1.10.1.1)
L-ascorbate-cytochrome-b5 reductase (1.10.2.1)
quinol-cytochrome-c reductase (1.10.2.2)
catechol oxidase (1.10.3.1)
laccase (1.10.3.2)
L-ascorbate oxidase (1.10.3.3)
o-aminophenol oxidase (1.10.3.4)
3-hydroxyanthranilate oxidase (1.10.3.5)
rifamycin-B oxidase (1.10.3.6)
sulochrin oxidase [(+)-bisdechlorogeodin-forming] (1.10.3.7)
sulochrin oxidase ((-)-bisdechlorogeodin-forming) (1.10.3.8)
photosystem II (1.10.3.9)
ubiquinol oxidase (H+-transporting) (1.10.3.10)
ubiquinol oxidase (non-electrogenic) (1.10.3.11)
menaquinol oxidase (H+-transporting) (1.10.3.12)
caldariellaquinol oxidase (H+-transporting) (1.10.3.13)
ubiquinol oxidase (electrogenic, non H+-transporting) (1.10.3.14)
grixazone synthase (1.10.3.15)
dihydrophenazinedicarboxylate synthase (1.10.3.16)
superoxide oxidase (1.10.3.17)
ribosyldihydronicotinamide dehydrogenase (quinone) (1.10.5.1)
plastoquinol-plastocyanin reductase (1.10.9.1)
plastoquinol-plastocyanin reductase (1.10.99.1)
ribosyldihydronicotinamide dehydrogenase (quinone) (1.10.99.2)
violaxanthin de-epoxidase (1.10.99.3)
NADH peroxidase (1.11.1.1)
chloride peroxidase (vanadium-containing) (1.11.1.B2)
NADPH peroxidase (1.11.1.2)
fatty-acid peroxidase (1.11.1.3)
Recommended Name never specified (1.11.1.4)
cytochrome-c peroxidase (1.11.1.5)
catalase (1.11.1.6)
iodide peroxidase (vanadium-containing) (1.11.1.B6)
bromide peroxidase (heme-containing) (1.11.1.B7)
peroxidase (1.11.1.7)
bromide peroxidase (metal-containing) (1.11.1.B8)
iodide peroxidase (1.11.1.8)
glutathione peroxidase (1.11.1.9)
chloride peroxidase (1.11.1.10)
D-ascorbate peroxidase (1.11.1.B10)
L-ascorbate peroxidase (1.11.1.11)
phospholipid-hydroperoxide glutathione peroxidase (1.11.1.12)
manganese peroxidase (1.11.1.13)
lignin peroxidase (1.11.1.14)
peroxiredoxin (1.11.1.15)
versatile peroxidase (1.11.1.16)
glutathione amide-dependent peroxidase (1.11.1.17)
bromide peroxidase (1.11.1.18)
dye decolorizing peroxidase (1.11.1.19)
prostamide/prostaglandin F2alpha synthase (1.11.1.20)
catalase-peroxidase (1.11.1.21)
hydroperoxy fatty acid reductase (1.11.1.22)
(S)-2-hydroxypropylphosphonic acid epoxidase (1.11.1.23)
thioredoxin-dependent peroxiredoxin (1.11.1.24)
glutaredoxin-dependent peroxiredoxin (1.11.1.25)
NADH-dependent peroxiredoxin (1.11.1.26)
glutathione-dependent peroxiredoxin (1.11.1.27)
lipoyl-dependent peroxiredoxin (1.11.1.28)
mycoredoxin-dependent peroxiredoxin (1.11.1.29)
unspecific peroxygenase (1.11.2.1)
myeloperoxidase (1.11.2.2)
plant seed peroxygenase (1.11.2.3)
fatty-acid peroxygenase (1.11.2.4)
3-methyl-L-tyrosine peroxygenase (1.11.2.5)
L-tyrosine peroxygenase (1.11.2.6)
peroxidase (1.12.1.1)
hydrogen dehydrogenase (1.12.1.2)
hydrogen dehydrogenase (NADP+) (1.12.1.3)
hydrogenase (NAD+, ferredoxin) (1.12.1.4)
hydrogen dehydrogenase [NAD(P)+] (1.12.1.5)
cytochrome-c3 hydrogenase (1.12.2.1)
hydrogen:quinone oxidoreductase (1.12.5.1)
ferredoxin hydrogenase (1.12.7.1)
ferredoxin hydrogenase (1.12.7.2)
coenzyme F420 hydrogenase (1.12.98.1)
hydrogen:sulfur oxidoreductase (1.12.98.B1)
5,10-methenyltetrahydromethanopterin hydrogenase (1.12.98.2)
Methanosarcina-phenazine hydrogenase (1.12.98.3)
sulfhydrogenase (1.12.98.4)
coenzyme F420 hydrogenase (1.12.99.1)
coenzyme-M-7-mercaptoheptanoylthreonine-phosphate-heterodisulfide hydrogenase (1.12.99.2)
hydrogen:quinone oxidoreductase (1.12.99.3)
N5,N10-methenyltetrahydromethanopterin hydrogenase (1.12.99.4)
3,4-dihydroxyquinoline 2,4-dioxygenase (1.12.99.5)
hydrogenase (acceptor) (1.12.99.6)
9,14-linoleate diol synthase (1.13.11.B1)
catechol 1,2-dioxygenase (1.13.11.1)
catechol 2,3-dioxygenase (1.13.11.2)
protocatechuate 3,4-dioxygenase (1.13.11.3)
gentisate 1,2-dioxygenase (1.13.11.4)
homogentisate 1,2-dioxygenase (1.13.11.5)
3-hydroxyanthranilate 3,4-dioxygenase (1.13.11.6)
linoleate 9/13-lipoxygenase (1.13.11.B6)
3,4-dihydroxyphenylacetate 3,4-dioxygenase (1.13.11.7)
protocatechuate 4,5-dioxygenase (1.13.11.8)
2,5-dihydroxypyridine 5,6-dioxygenase (1.13.11.9)
7,8-dihydroxykynurenate 8,8a-dioxygenase (1.13.11.10)
tryptophan 2,3-dioxygenase (1.13.11.11)
linoleate 13S-lipoxygenase (1.13.11.12)
ascorbate 2,3-dioxygenase (1.13.11.13)
2,3-dihydroxybenzoate 3,4-dioxygenase (1.13.11.14)
3,4-dihydroxyphenylacetate 2,3-dioxygenase (1.13.11.15)
3-carboxyethylcatechol 2,3-dioxygenase (1.13.11.16)
indole 2,3-dioxygenase (1.13.11.17)
persulfide dioxygenase (1.13.11.18)
cysteamine dioxygenase (1.13.11.19)
cysteine dioxygenase (1.13.11.20)
beta-carotene 15,15'-dioxygenase (1.13.11.21)
caffeate 3,4-dioxygenase (1.13.11.22)
2,3-dihydroxyindole 2,3-dioxygenase (1.13.11.23)
quercetin 2,3-dioxygenase (1.13.11.24)
3,4-dihydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione 4,5-dioxygenase (1.13.11.25)
peptide-tryptophan 2,3-dioxygenase (1.13.11.26)
4-hydroxyphenylpyruvate dioxygenase (1.13.11.27)
2,3-dihydroxybenzoate 2,3-dioxygenase (1.13.11.28)
stizolobate synthase (1.13.11.29)
stizolobinate synthase (1.13.11.30)
arachidonate 12-lipoxygenase (1.13.11.31)
2-nitropropane dioxygenase (1.13.11.32)
arachidonate 15-lipoxygenase (1.13.11.33)
arachidonate 5-lipoxygenase (1.13.11.34)
pyrogallol 1,2-oxygenase (1.13.11.35)
chloridazon-catechol dioxygenase (1.13.11.36)
hydroxyquinol 1,2-dioxygenase (1.13.11.37)
1-hydroxy-2-naphthoate 1,2-dioxygenase (1.13.11.38)
biphenyl-2,3-diol 1,2-dioxygenase (1.13.11.39)
arachidonate 8-lipoxygenase (1.13.11.40)
2,4'-dihydroxyacetophenone dioxygenase (1.13.11.41)
indoleamine-pyrrole 2,3-dioxygenase (1.13.11.42)
lignostilbene alphabeta-dioxygenase (1.13.11.43)
linoleate diol synthase (1.13.11.44)
linoleate 11-lipoxygenase (1.13.11.45)
4-hydroxymandelate synthase (1.13.11.46)
3-hydroxy-4-oxoquinoline 2,4-dioxygenase (1.13.11.47)
3-hydroxy-2-methylquinolin-4-one 2,4-dioxygenase (1.13.11.48)
chlorite O2-lyase (1.13.11.49)
acetylacetone-cleaving enzyme (1.13.11.50)
9-cis-epoxycarotenoid dioxygenase (1.13.11.51)
indoleamine 2,3-dioxygenase (1.13.11.52)
acireductone dioxygenase (Ni2+-requiring) (1.13.11.53)
acireductone dioxygenase [iron(II)-requiring] (1.13.11.54)
sulfur oxygenase/reductase (1.13.11.55)
1,2-dihydroxynaphthalene dioxygenase (1.13.11.56)
gallate dioxygenase (1.13.11.57)
linoleate 9S-lipoxygenase (1.13.11.58)
torulene dioxygenase (1.13.11.59)
linoleate 8R-lipoxygenase (1.13.11.60)
linolenate 9R-lipoxygenase (1.13.11.61)
linoleate 10R-lipoxygenase (1.13.11.62)
beta-carotene 15,15'-dioxygenase (1.13.11.63)
5-nitrosalicylate dioxygenase (1.13.11.64)
carotenoid isomerooxygenase (1.13.11.65)
hydroquinone 1,2-dioxygenase (1.13.11.66)
8'-apo-beta-carotenoid 14',13'-cleaving dioxygenase (1.13.11.67)
9-cis-beta-carotene 9',10'-cleaving dioxygenase (1.13.11.68)
carlactone synthase (1.13.11.69)
all-trans-10'-apo-beta-carotenal 13,14-cleaving dioxygenase (1.13.11.70)
carotenoid-9',10'-cleaving dioxygenase (1.13.11.71)
2-hydroxyethylphosphonate dioxygenase (1.13.11.72)
methylphosphonate synthase (1.13.11.73)
2-aminophenol 1,6-dioxygenase (1.13.11.74)
all-trans-8'-apo-beta-carotenal 15,15'-oxygenase (1.13.11.75)
2-amino-5-chlorophenol 1,6-dioxygenase (1.13.11.76)
oleate 10S-lipoxygenase (1.13.11.77)
2-amino-1-hydroxyethylphosphonate dioxygenase (glycine-forming) (1.13.11.78)
aerobic 5,6-dimethylbenzimidazole synthase (1.13.11.79)
(3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase (1.13.11.80)
7,8-dihydroneopterin oxygenase (1.13.11.81)
8'-apo-carotenoid 13,14-cleaving dioxygenase (1.13.11.82)
4-hydroxy-3-prenylphenylpyruvate oxygenase (1.13.11.83)
crocetin dialdehyde synthase (1.13.11.84)
exo-cleaving rubber dioxygenase (1.13.11.85)
5-aminosalicylate 1,2-dioxygenase (1.13.11.86)
endo-cleaving rubber dioxygenase (1.13.11.87)
isoeugenol monooxygenase (1.13.11.88)
(hydroxymethyl)phosphonate dioxygenase (1.13.11.89)
[1-hydroxy-2-(trimethylamino)ethyl]phosphonate dioxygenase (glycine-betaine-forming) (1.13.11.90)
3-mercaptopropionate dioxygenase (1.13.11.91)
fatty acid alpha-dioxygenase (1.13.11.92)
2-oxoadipate dioxygenase/decarboxylase (1.13.11.93)
arginine 2-monooxygenase (1.13.12.1)
lysine 2-monooxygenase (1.13.12.2)
tryptophan 2-monooxygenase (1.13.12.3)
lactate 2-monooxygenase (1.13.12.4)
Arachnocampa luciferase (1.13.12.B5)
Renilla-type luciferase (1.13.12.5)
Cypridina-luciferin 2-monooxygenase (1.13.12.6)
firefly luciferase (1.13.12.7)
Watasenia-luciferin 2-monooxygenase (1.13.12.8)
phenylalanine 2-monooxygenase (1.13.12.9)
lysine 6-monooxygenase (1.13.12.10)
methylphenyltetrahydropyridine N-monooxygenase (1.13.12.11)
apo-beta-carotenoid-14',13'-dioxygenase (1.13.12.12)
Oplophorus-luciferin 2-monooxygenase (1.13.12.13)
chlorophyllide-a oxygenase (1.13.12.14)
3,4-dihydroxyphenylalanine oxidative deaminase (1.13.12.15)
nitronate monooxygenase (1.13.12.16)
dichloroarcyriaflavin A synthase (1.13.12.17)
dinoflagellate luciferase (1.13.12.18)
2-oxoglutarate dioxygenase (ethene-forming) (1.13.12.19)
noranthrone monooxygenase (1.13.12.20)
tetracenomycin-F1 monooxygenase (1.13.12.21)
deoxynogalonate monooxygenase (1.13.12.22)
4-hydroxy-3-prenylbenzoate synthase (1.13.12.23)
calcium-regulated photoprotein (1.13.12.24)
exo-cleaving rubber dioxygenase (1.13.99.B1)
inositol oxygenase (1.13.99.1)
benzoate 1,2-dioxygenase (1.13.99.2)
tryptophan 2'-dioxygenase (1.13.99.3)
4-chlorophenylacetate 3,4-dioxygenase (1.13.99.4)
3,4-dihydroxyquinoline 2,4-dioxygenase (1.13.99.5)
gamma-butyrobetaine dioxygenase (1.14.11.1)
procollagen-proline 4-dioxygenase (1.14.11.2)
L-proline cis-4-hydroxylase (1.14.11.B3)
pyrimidine-deoxynucleoside 2'-dioxygenase (1.14.11.3)
procollagen-lysine 5-dioxygenase (1.14.11.4)
5-hydroxymethyluracil,2-oxoglutarate dioxygenase (1.14.11.5)
thymine dioxygenase (1.14.11.6)
procollagen-proline 3-dioxygenase (1.14.11.7)
trimethyllysine dioxygenase (1.14.11.8)
flavanone 3-dioxygenase (1.14.11.9)
pyrimidine-deoxynucleoside 1'-dioxygenase (1.14.11.10)
hyoscyamine (6S)-dioxygenase (1.14.11.11)
gibberellin-44 dioxygenase (1.14.11.12)
gibberellin 2beta-dioxygenase (1.14.11.13)
6beta-hydroxyhyoscyamine epoxidase (1.14.11.14)
gibberellin 3beta-dioxygenase (1.14.11.15)
S-(L-glutamyl)-[peptidyl-carrier protein]-3-hydroxylase (3-hydroxylating, erythro-hydroxy-L-glutamyl-[peptidyl-carrier-protein]-forming) (1.14.11.B15)
carotenoid 4,4'-beta-ionone ring oxygenase (1.14.11.B16)
peptide-aspartate beta-dioxygenase (1.14.11.16)
S-(L-glutamyl)-[peptidyl-carrier protein]-3-hydroxylase (3-hydroxylating, S-(threo-3-hydroxy-L-glutamyl)-[peptidyl-carrier-protein]-forming) (1.14.11.B17)
taurine dioxygenase (1.14.11.17)
chalcone 3-hydroxylase (1.14.11.B18)
phytanoyl-CoA dioxygenase (1.14.11.18)
leucocyanidin oxygenase (1.14.11.19)
[histone H3]-trimethyl-L-lysine56 demethylase (1.14.11.B19)
deacetoxyvindoline 4-hydroxylase (1.14.11.20)
clavaminate synthase (1.14.11.21)
ergot alkaloid dioxygenase (1.14.11.B22)
flavone synthase (1.14.11.22)
flavonol synthase (1.14.11.23)
2'-deoxymugineic-acid 2'-dioxygenase (1.14.11.24)
mugineic-acid 3-dioxygenase (1.14.11.25)
deacetoxycephalosporin-C hydroxylase (1.14.11.26)
[histone H3]-dimethyl-L-lysine36 demethylase (1.14.11.27)
proline 3-hydroxylase (1.14.11.28)
hypoxia-inducible factor-proline dioxygenase (1.14.11.29)
hypoxia-inducible factor-asparagine dioxygenase (1.14.11.30)
thebaine 6-O-demethylase (1.14.11.31)
codeine 3-O-demethylase (1.14.11.32)
DNA oxidative demethylase (1.14.11.33)
2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming) (1.14.11.34)
1-deoxypentalenic acid 11beta-hydroxylase (1.14.11.35)
pentalenolactone F synthase (1.14.11.36)
kanamycin B dioxygenase (1.14.11.37)
verruculogen synthase (1.14.11.38)
L-asparagine hydroxylase (1.14.11.39)
enduracididine beta-hydroxylase (1.14.11.40)
L-arginine hydroxylase (1.14.11.41)
tRNAPhe (7-(3-amino-3-carboxypropyl)wyosine37-C2)-hydroxylase (1.14.11.42)
(S)-dichlorprop dioxygenase (2-oxoglutarate) (1.14.11.43)
(R)-dichlorprop dioxygenase (2-oxoglutarate) (1.14.11.44)
L-isoleucine 4-hydroxylase (1.14.11.45)
2-aminoethylphosphonate dioxygenase (1.14.11.46)
[50S ribosomal protein L16]-arginine 3-hydroxylase (1.14.11.47)
xanthine dioxygenase (1.14.11.48)
uridine-5'-phosphate dioxygenase (1.14.11.49)
(-)-deoxypodophyllotoxin synthase (1.14.11.50)
DNA N6-methyladenine demethylase (1.14.11.51)
validamycin A dioxygenase (1.14.11.52)
mRNA N6-methyladenine demethylase (1.14.11.53)
mRNA N1-methyladenine demethylase (1.14.11.54)
ectoine hydroxylase (1.14.11.55)
L-proline cis-4-hydroxylase (1.14.11.56)
L-proline trans-4-hydroxylase (1.14.11.57)
ornithine lipid ester-linked acyl 2-hydroxylase (1.14.11.58)
2,4-dihydroxy-1,4-benzoxazin-3-one-glucoside dioxygenase (1.14.11.59)
scopoletin 8-hydroxylase (1.14.11.60)
feruloyl-CoA 6-hydroxylase (1.14.11.61)
trans-4-coumaroyl-CoA 2-hydroxylase (1.14.11.62)
peptidyl-lysine (3S)-dioxygenase (1.14.11.63)
glutarate dioxygenase (1.14.11.64)
[histone H3]-dimethyl-L-lysine9 demethylase (1.14.11.65)
[histone H3]-trimethyl-L-lysine9 demethylase (1.14.11.66)
[histone H3]-trimethyl-L-lysine4 demethylase (1.14.11.67)
[histone H3]-trimethyl-L-lysine27 demethylase (1.14.11.68)
[histone H3]-trimethyl-L-lysine36 demethylase (1.14.11.69)
7-deoxycylindrospermopsin hydroxylase (1.14.11.70)
methylphosphonate hydroxylase (1.14.11.71)
[2-(trimethylamino)ethyl]phosphonate dioxygenase (1.14.11.72)
[protein]-arginine 3-hydroxylase (1.14.11.73)
L-isoleucine 31-dioxygenase (1.14.11.74)
31-hydroxy-L-isoleucine 4-dioxygenase (1.14.11.75)
L-glutamate 3(R)-hydroxylase (1.14.11.76)
alkyl sulfatase (1.14.11.77)
(R)-3-[(carboxymethyl)amino]fatty acid dioxygenase/decarboxylase (1.14.11.78)
protein-L-histidine (3S)-3-hydroxylase (1.14.11.79)
anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (1.14.12.1)
anthranilate 2,3-dioxygenase (deaminating) (1.14.12.2)
benzene 1,2-dioxygenase (1.14.12.3)
3-hydroxy-2-methylpyridinecarboxylate dioxygenase (1.14.12.4)
5-pyridoxate dioxygenase (1.14.12.5)
2-hydroxycyclohexanone 2-monooxygenase (1.14.12.6)
phthalate 4,5-dioxygenase (1.14.12.7)
4-sulfobenzoate 3,4-dioxygenase (1.14.12.8)
4-chlorophenylacetate 3,4-dioxygenase (1.14.12.9)
benzoate 1,2-dioxygenase (1.14.12.10)
toluene dioxygenase (1.14.12.11)
naphthalene 1,2-dioxygenase (1.14.12.12)
2-halobenzoate 1,2-dioxygenase (1.14.12.13)
2-aminobenzenesulfonate 2,3-dioxygenase (1.14.12.14)
terephthalate 1,2-dioxygenase (1.14.12.15)
2-Hydroxyquinoline 5,6-dioxygenase (1.14.12.16)
nitric oxide dioxygenase (1.14.12.17)
biphenyl 2,3-dioxygenase (1.14.12.18)
3-phenylpropanoate dioxygenase (1.14.12.19)
pheophorbide a oxygenase (1.14.12.20)
benzoyl-CoA 2,3-dioxygenase (1.14.12.21)
carbazole 1,9a-dioxygenase (1.14.12.22)
nitroarene dioxygenase (1.14.12.23)
2,4-dinitrotoluene dioxygenase (1.14.12.24)
p-cumate 2,3-dioxygenase (1.14.12.25)
chlorobenzene dioxygenase (1.14.12.26)
3,6-diketocamphane 1,2-monooxygenase (1.14.13.B1)
salicylate 1-monooxygenase (1.14.13.1)
4-hydroxybenzoate 3-monooxygenase (1.14.13.2)
4-hydroxyphenylacetate 3-monooxygenase (1.14.13.3)
melilotate 3-monooxygenase (1.14.13.4)
imidazoleacetate 4-monooxygenase (1.14.13.5)
orcinol 2-monooxygenase (1.14.13.6)
phenol 2-monooxygenase (NADPH) (1.14.13.7)
flavin-containing monooxygenase (1.14.13.8)
kynurenine 3-monooxygenase (1.14.13.9)
2,6-dihydroxypyridine 3-monooxygenase (1.14.13.10)
trans-cinnamate 4-monooxygenase (1.14.13.11)
benzoate 4-monooxygenase (1.14.13.12)
calcidiol 1-monooxygenase (1.14.13.13)
trans-cinnamate 2-monooxygenase (1.14.13.14)
trimethyltridecatetraene synthase (1.14.13.B14)
cholestanetriol 26-monooxygenase (1.14.13.15)
cyclopentanone monooxygenase (1.14.13.16)
cholesterol 7alpha-monooxygenase (1.14.13.17)
4-hydroxyphenylacetate 1-monooxygenase (1.14.13.18)
taxifolin 8-monooxygenase (1.14.13.19)
2,4-dichlorophenol 6-monooxygenase (1.14.13.20)
flavonoid 3'-monooxygenase (1.14.13.21)
cyclohexanone monooxygenase (1.14.13.22)
3-hydroxybenzoate 4-monooxygenase (1.14.13.23)
3-hydroxybenzoate 6-monooxygenase (1.14.13.24)
methane monooxygenase (soluble) (1.14.13.25)
phosphatidylcholine 12-monooxygenase (1.14.13.26)
4-aminobenzoate 1-monooxygenase (1.14.13.27)
3,9-dihydroxypterocarpan 6a-monooxygenase (1.14.13.28)
monooxygenase CYP119A2 (1.14.13.B28)
4-nitrophenol 2-monooxygenase (1.14.13.29)
leukotriene-B4 20-monooxygenase (1.14.13.30)
rifampicin monooxygenase (1.14.13.B30)
2-nitrophenol 2-monooxygenase (1.14.13.31)
albendazole monooxygenase (1.14.13.32)
4-hydroxybenzoate 3-monooxygenase [NAD(P)H] (1.14.13.33)
leukotriene-E4 20-monooxygenase (1.14.13.34)
N-demethylase reductase (1.14.13.B34)
anthranilate 3-monooxygenase (deaminating) (1.14.13.35)
5-O-(4-coumaroyl)-D-quinate 3'-monooxygenase (1.14.13.36)
methyltetrahydroprotoberberine 14-monooxygenase (1.14.13.37)
anhydrotetracycline 6-monooxygenase (1.14.13.38)
nitric-oxide synthase (NADPH) (1.14.13.39)
anthraniloyl-CoA monooxygenase (1.14.13.40)
tyrosine N-monooxygenase (1.14.13.41)
hydroxyphenylacetonitrile 2-monooxygenase (1.14.13.42)
questin monooxygenase (1.14.13.43)
2-hydroxybiphenyl 3-monooxygenase (1.14.13.44)
CMP-N-acetylneuraminate monooxygenase (1.14.13.45)
(-)-menthol monooxygenase (1.14.13.46)
(S)-limonene 3-monooxygenase (1.14.13.47)
(S)-limonene 6-monooxygenase (1.14.13.48)
(S)-limonene 7-monooxygenase (1.14.13.49)
pentachlorophenol monooxygenase (1.14.13.50)
6-oxocineole dehydrogenase (1.14.13.51)
isoflavone 3'-hydroxylase (1.14.13.52)
4'-methoxyisoflavone 2'-hydroxylase (1.14.13.53)
ketosteroid monooxygenase (1.14.13.54)
protopine 6-monooxygenase (1.14.13.55)
dihydrosanguinarine 10-monooxygenase (1.14.13.56)
dihydrochelirubine 12-monooxygenase (1.14.13.57)
benzoyl-CoA 3-monooxygenase (1.14.13.58)
L-lysine N6-monooxygenase (NADPH) (1.14.13.59)
27-hydroxycholesterol 7alpha-monooxygenase (1.14.13.60)
2-hydroxyquinoline 8-monooxygenase (1.14.13.61)
4-hydroxyquinoline 3-monooxygenase (1.14.13.62)
3-hydroxyphenylacetate 6-hydroxylase (1.14.13.63)
4-hydroxybenzoate 1-hydroxylase (1.14.13.64)
2-hydroxyquinoline 8-monooxygenase (1.14.13.65)
2-hydroxycyclohexanone 2-monooxygenase (1.14.13.66)
quinine 3-monooxygenase (1.14.13.67)
4-hydroxyphenylacetaldehyde oxime monooxygenase (1.14.13.68)
alkene monooxygenase (1.14.13.69)
sterol 14alpha-demethylase (1.14.13.70)
N-methylcoclaurine 3'-monooxygenase (1.14.13.71)
methylsterol monooxygenase (1.14.13.72)
tabersonine 16-hydroxylase (1.14.13.73)
7-deoxyloganin 7-hydroxylase (1.14.13.74)
vinorine hydroxylase (1.14.13.75)
taxane 10beta-hydroxylase (1.14.13.76)
taxane 13alpha-hydroxylase (1.14.13.77)
ent-kaurene oxidase (1.14.13.78)
ent-kaurenoic acid oxidase (1.14.13.79)
(R)-limonene 6-monooxygenase (1.14.13.80)
magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase (1.14.13.81)
vanillate monooxygenase (1.14.13.82)
precorrin-3B synthase (1.14.13.83)
4-hydroxyacetophenone monooxygenase (1.14.13.84)
glyceollin synthase (1.14.13.85)
2-hydroxyisoflavanone synthase (1.14.13.86)
licodione synthase (1.14.13.87)
flavanoid 3,5-hydroxylase (1.14.13.88)
isoflavone 2-hydroxylase (1.14.13.89)
zeaxanthin epoxidase (1.14.13.90)
deoxysarpagine hydroxylase (1.14.13.91)
phenylacetone monooxygenase (1.14.13.92)
(+)-abscisic acid 8'-hydroxylase (1.14.13.93)
lithocholate 6beta-hydroxylase (1.14.13.94)
7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase (1.14.13.95)
5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase (1.14.13.96)
taurochenodeoxycholate 6alpha-hydroxylase (1.14.13.97)
cholesterol 24-hydroxylase (1.14.13.98)
24-hydroxycholesterol 7alpha-hydroxylase (1.14.13.99)
25/26-hydroxycholesterol 7alpha-hydroxylase (1.14.13.100)
senecionine N-oxygenase (1.14.13.101)
psoralen synthase (1.14.13.102)
8-dimethylallylnaringenin 2-hydroxylase (1.14.13.103)
(+)-menthofuran synthase (1.14.13.104)
monocyclic monoterpene ketone monooxygenase (1.14.13.105)
epi-isozizaene 5-monooxygenase (1.14.13.106)
limonene 1,2-monooxygenase (1.14.13.107)
abieta-7,13-diene hydroxylase (1.14.13.108)
abieta-7,13-dien-18-ol hydroxylase (1.14.13.109)
geranylgeraniol 18-hydroxylase (1.14.13.110)
methanesulfonate monooxygenase (NADH) (1.14.13.111)
3-epi-6-deoxocathasterone 23-monooxygenase (1.14.13.112)
FAD-dependent urate hydroxylase (1.14.13.113)
6-hydroxynicotinate 3-monooxygenase (1.14.13.114)
angelicin synthase (1.14.13.115)
geranylhydroquinone 3''-hydroxylase (1.14.13.116)
isoleucine N-monooxygenase (1.14.13.117)
valine N-monooxygenase (1.14.13.118)
5-epiaristolochene 1,3-dihydroxylase (1.14.13.119)
costunolide synthase (1.14.13.120)
premnaspirodiene oxygenase (1.14.13.121)
chlorophyllide-a oxygenase (1.14.13.122)
germacrene A hydroxylase (1.14.13.123)
phenylalanine N-monooxygenase (1.14.13.124)
tryptophan N-monooxygenase (1.14.13.125)
vitamin D3 24-hydroxylase (1.14.13.126)
3-(3-hydroxyphenyl)propanoate hydroxylase (1.14.13.127)
7-methylxanthine demethylase (1.14.13.128)
beta-carotene 3-hydroxylase (1.14.13.129)
pyrrole-2-carboxylate monooxygenase (1.14.13.130)
dissimilatory dimethyl sulfide monooxygenase (1.14.13.131)
squalene monooxygenase (1.14.13.132)
pentalenene oxygenase (1.14.13.133)
beta-amyrin 11-oxidase (1.14.13.134)
1-hydroxy-2-naphthoate hydroxylase (1.14.13.135)
2-hydroxyisoflavanone synthase (1.14.13.136)
indole-2-monooxygenase (1.14.13.137)
indolin-2-one monooxygenase (1.14.13.138)
3-hydroxyindolin-2-one monooxygenase (1.14.13.139)
2-hydroxy-1,4-benzoxazin-3-one monooxygenase (1.14.13.140)
cholest-4-en-3-one 26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming] (1.14.13.141)
3-ketosteroid 9alpha-monooxygenase (1.14.13.142)
ent-isokaurene C2-hydroxylase (1.14.13.143)
9beta-pimara-7,15-diene oxidase (1.14.13.144)
ent-cassa-12,15-diene 11-hydroxylase (1.14.13.145)
taxoid 14beta-hydroxylase (1.14.13.146)
taxoid 7beta-hydroxylase (1.14.13.147)
trimethylamine monooxygenase (1.14.13.148)
phenylacetyl-CoA 1,2-epoxidase (1.14.13.149)
alpha-humulene 10-hydroxylase (1.14.13.150)
linalool 8-monooxygenase (1.14.13.151)
geraniol 8-hydroxylase (1.14.13.152)
(+)-sabinene 3-hydroxylase (1.14.13.153)
erythromycin 12-hydroxylase (1.14.13.154)
alpha-pinene monooxygenase (1.14.13.155)
1,8-cineole 2-endo-monooxygenase (1.14.13.156)
1,8-cineole 2-exo-monooxygenase (1.14.13.157)
amorpha-4,11-diene 12-monooxygenase (1.14.13.158)
vitamin D 25-hydroxylase (1.14.13.159)
(2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase (1.14.13.160)
(+)-camphor 6-exo-hydroxylase (1.14.13.161)
2,5-diketocamphane 1,2-monooxygenase (1.14.13.162)
6-hydroxy-3-succinoylpyridine 3-monooxygenase (1.14.13.163)
4-nitrocatechol 4-monooxygenase (1.14.13.166)
4-nitrophenol 4-monooxygenase (1.14.13.167)
indole-3-pyruvate monooxygenase (1.14.13.168)
sphinganine C4-monooxygenase (1.14.13.169)
pentalenolactone D synthase (1.14.13.170)
neopentalenolactone D synthase (1.14.13.171)
salicylate 5-hydroxylase (1.14.13.172)
11-oxo-beta-amyrin 30-oxidase (1.14.13.173)
averantin hydroxylase (1.14.13.174)
aflatoxin B synthase (1.14.13.175)
tryprostatin B 6-hydroxylase (1.14.13.176)
fumitremorgin C monooxygenase (1.14.13.177)
methylxanthine N1-demethylase (1.14.13.178)
methylxanthine N3-demethylase (1.14.13.179)
aklavinone 12-hydroxylase (1.14.13.180)
13-deoxydaunorubicin hydroxylase (1.14.13.181)
2-heptyl-3-hydroxy-4(1H)-quinolone synthase (1.14.13.182)
dammarenediol 12-hydroxylase (1.14.13.183)
protopanaxadiol 6-hydroxylase (1.14.13.184)
pikromycin synthase (1.14.13.185)
20-oxo-5-O-mycaminosyltylactone 23-monooxygenase (1.14.13.186)
L-evernosamine nitrososynthase (1.14.13.187)
6-deoxyerythronolide B hydroxylase (1.14.13.188)
5-methyl-1-naphthoate 3-hydroxylase (1.14.13.189)
ferruginol synthase (1.14.13.190)
ent-sandaracopimaradiene 3-hydroxylase (1.14.13.191)
oryzalexin E synthase (1.14.13.192)
oryzalexin D synthase (1.14.13.193)
phylloquinone omega-hydroxylase (1.14.13.194)
L-ornithine N5-monooxygenase (NADPH) (1.14.13.195)
L-ornithine N5-monooxygenase [NAD(P)H] (1.14.13.196)
dihydromonacolin L hydroxylase (1.14.13.197)
monacolin L hydroxylase (1.14.13.198)
docosahexaenoic acid omega-hydroxylase (1.14.13.199)
tetracenomycin A2 monooxygenase-dioxygenase (1.14.13.200)
beta-amyrin 28-monooxygenase (1.14.13.201)
methyl farnesoate epoxidase (1.14.13.202)
farnesoate epoxidase (1.14.13.203)
long-chain acyl-CoA omega-monooxygenase (1.14.13.204)
long-chain fatty acid omega-monooxygenase (1.14.13.205)
laurate 7-monooxygenase (1.14.13.206)
ipsdienol synthase (1.14.13.207)
benzoyl-CoA 2,3-epoxidase (1.14.13.208)
salicyloyl-CoA 5-hydroxylase (1.14.13.209)
4-methyl-5-nitrocatechol 5-monooxygenase (1.14.13.210)
rifampicin monooxygenase (1.14.13.211)
1,3,7-trimethyluric acid 5-monooxygenase (1.14.13.212)
bursehernin 5-monooxygenase (1.14.13.213)
(-)-4'-demethyl-deoxypodophyllotoxin 4-hydroxylase (1.14.13.214)
protoasukamycin 4-monooxygenase (1.14.13.215)
asperlicin C monooxygenase (1.14.13.216)
protodeoxyviolaceinate monooxygenase (1.14.13.217)
5-methylphenazine-1-carboxylate 1-monooxygenase (1.14.13.218)
resorcinol 4-hydroxylase (NADPH) (1.14.13.219)
resorcinol 4-hydroxylase (NADH) (1.14.13.220)
cholest-4-en-3-one 26-monooxygenase [(25R)-3-oxocholest-4-en-26-oate forming] (1.14.13.221)
aurachin C monooxygenase/isomerase (1.14.13.222)
3-hydroxy-4-methylanthranilyl-[aryl-carrier protein] 5-monooxygenase (1.14.13.223)
violacein synthase (1.14.13.224)
F-actin monooxygenase (1.14.13.225)
acetone monooxygenase (methyl acetate-forming) (1.14.13.226)
propane 2-monooxygenase (1.14.13.227)
jasmonic acid 12-hydroxylase (1.14.13.228)
tert-butyl alcohol monooxygenase (1.14.13.229)
butane monooxygenase (soluble) (1.14.13.230)
tetracycline 11a-monooxygenase (1.14.13.231)
6-methylpretetramide 4-monooxygenase (1.14.13.232)
4-hydroxy-6-methylpretetramide 12a-monooxygenase (1.14.13.233)
5a,11a-dehydrotetracycline 5-monooxygenase (1.14.13.234)
indole-3-acetate monooxygenase (1.14.13.235)
toluene 4-monooxygenase (1.14.13.236)
aliphatic glucosinolate S-oxygenase (1.14.13.237)
dimethylamine monooxygenase (1.14.13.238)
carnitine monooxygenase (1.14.13.239)
2-polyprenylphenol 6-hydroxylase (1.14.13.240)
5-pyridoxate monooxygenase (1.14.13.241)
3-hydroxy-2-methylpyridine-5-carboxylate monooxygenase (1.14.13.242)
toluene 2-monooxygenase (1.14.13.243)
phenol 2-monooxygenase (NADH) (1.14.13.244)
assimilatory dimethylsulfide S-monooxygenase (1.14.13.245)
4beta-methylsterol monooxygenase (1.14.13.246)
stachydrine N-demethylase (1.14.13.247)
L-aspartate N-monooxygenase (nitrosuccinate-forming) (1.14.13.248)
3-amino-4-hydroxybenzoate 2-monooxygenase (1.14.13.249)
nitrosourea synthase (1.14.13.250)
glycine betaine monooxygenase (1.14.13.251)
unspecific monooxygenase (1.14.14.1)
benzopyrene 3-monooxygenase (1.14.14.2)
bacterial luciferase (1.14.14.3)
choline monooxygenase (1.14.14.4)
alkanesulfonate monooxygenase (1.14.14.5)
methanesulfonate monooxygenase (1.14.14.6)
tryptophan 7-halogenase (1.14.14.7)
anthranilate 3-monooxygenase (FAD) (1.14.14.8)
4-hydroxyphenylacetate 3-monooxygenase (1.14.14.9)
fatty acid omega2/3-hydroxyase (1.14.14.B9)
heme oxygenase (hematinic acid-producing) (1.14.14.B10)
nitrilotriacetate monooxygenase (1.14.14.10)
nicotine demethylase (1.14.14.B11)
styrene monooxygenase (1.14.14.11)
3-hydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione monooxygenase (1.14.14.12)
4-(gamma-L-glutamylamino)butanoyl-[BtrI acyl-carrier protein] monooxygenase (1.14.14.13)
coniferylaldehyde 5-hydroxylase (1.14.14.B13)
2-aminobenzoylacetate 2-monooxygenase (1.14.14.B14)
aromatase (1.14.14.14)
(3S)-3-amino-3-(3-chloro-4-hydroxyphenyl)propanoyl-[peptidyl-carrier protein SgcC2] monooxygenase (1.14.14.15)
steroid 21-monooxygenase (1.14.14.16)
squalene monooxygenase (1.14.14.17)
heme oxygenase (biliverdin-producing) (1.14.14.18)
steroid 17alpha-monooxygenase (1.14.14.19)
phenol 2-monooxygenase (FADH2) (1.14.14.20)
dibenzothiophene monooxygenase (1.14.14.21)
dibenzothiophene sulfone monooxygenase (1.14.14.22)
cholesterol 7alpha-monooxygenase (1.14.14.23)
vitamin D 25-hydroxylase (1.14.14.24)
cholesterol 24-hydroxylase (1.14.14.25)
24-hydroxycholesterol 7alpha-hydroxylase (1.14.14.26)
resorcinol 4-hydroxylase (FADH2) (1.14.14.27)
long-chain alkane monooxygenase (1.14.14.28)
25/26-hydroxycholesterol 7alpha-hydroxylase (1.14.14.29)
isobutylamine N-monooxygenase (1.14.14.30)
ipsdienol synthase (1.14.14.31)
17alpha-hydroxyprogesterone deacetylase (1.14.14.32)
ethylenediaminetetraacetate monooxygenase (1.14.14.33)
methanesulfonate monooxygenase (FMNH2) (1.14.14.34)
dimethylsulfone monooxygenase (1.14.14.35)
tyrosine N-monooxygenase (1.14.14.36)
4-hydroxyphenylacetaldehyde oxime monooxygenase (1.14.14.37)
valine N-monooxygenase (1.14.14.38)
isoleucine N-monooxygenase (1.14.14.39)
phenylalanine N-monooxygenase (1.14.14.40)
(E)-2-methylbutanal oxime monooxygenase (1.14.14.41)
homomethionine N-monooxygenase (1.14.14.42)
(methylsulfanyl)alkanaldoxime N-monooxygenase (1.14.14.43)
phenylacetaldehyde oxime monooxygenase (1.14.14.44)
aromatic aldoxime N-monooxygenase (1.14.14.45)
pimeloyl-[acyl-carrier protein] synthase (1.14.14.46)
nitric-oxide synthase (flavodoxin) (1.14.14.47)
jasmonoyl-L-amino acid 12-hydroxylase (1.14.14.48)
12-hydroxyjasmonoyl-L-amino acid 12-hydroxylase (1.14.14.49)
tabersonine 3-oxygenase (1.14.14.50)
(S)-limonene 6-monooxygenase (1.14.14.51)
(S)-limonene 7-monooxygenase (1.14.14.52)
(R)-limonene 6-monooxygenase (1.14.14.53)
phenylacetate 2-hydroxylase (1.14.14.54)
quinine 3-monooxygenase (1.14.14.55)
1,8-cineole 2-exo-monooxygenase (1.14.14.56)
taurochenodeoxycholate 6alpha-hydroxylase (1.14.14.57)
trimethyltridecatetraene synthase (1.14.14.58)
dimethylnonatriene synthase (1.14.14.59)
ferruginol monooxygenase (1.14.14.60)
carnosic acid synthase (1.14.14.61)
salviol synthase (1.14.14.62)
beta-amyrin 16beta-monooxygenase (1.14.14.63)
beta-amyrin 6beta-monooxygenase (1.14.14.64)
sugiol synthase (1.14.14.65)
marmesin synthase (1.14.14.66)
11-hydroxysugiol 20-monooxygenase (1.14.14.67)
syn-pimaradiene 3-monooxygenase (1.14.14.68)
ent-cassadiene hydroxylase (1.14.14.69)
ent-sandaracopimaradiene 3-hydroxylase (1.14.14.70)
cucurbitadienol 11-hydroxylase (1.14.14.71)
drimenol monooxygenase (1.14.14.72)
albendazole monooxygenase (sulfoxide-forming) (1.14.14.73)
albendazole monooxygenase (hydroxylating) (1.14.14.74)
fenbendazole monooxygenase (4'-hydroxylating) (1.14.14.75)
ent-isokaurene C2/C3-hydroxylase (1.14.14.76)
phenylacetonitrile alpha-monooxygenase (1.14.14.77)
phylloquinone omega-hydroxylase (1.14.14.78)
docosahexaenoic acid omega-hydroxylase (1.14.14.79)
long-chain fatty acid omega-monooxygenase (1.14.14.80)
flavanoid 3',5'-hydroxylase (1.14.14.81)
flavonoid 3'-monooxygenase (1.14.14.82)
geraniol 8-hydroxylase (1.14.14.83)
linalool 8-monooxygenase (1.14.14.84)
7-deoxyloganate 7-hydroxylase (1.14.14.85)
ent-kaurene monooxygenase (1.14.14.86)
2-hydroxyisoflavanone synthase (1.14.14.87)
isoflavone 3'-hydroxylase (1.14.14.88)
4'-methoxyisoflavone 2'-hydroxylase (1.14.14.89)
isoflavone 2'-hydroxylase (1.14.14.90)
trans-cinnamate 4-monooxygenase (1.14.14.91)
benzoate 4-monooxygenase (1.14.14.92)
3,9-dihydroxypterocarpan 6a-monooxygenase (1.14.14.93)
leukotriene-B4 20-monooxygenase (1.14.14.94)
germacrene A hydroxylase (1.14.14.95)
5-O-(4-coumaroyl)-D-quinate 3'-monooxygenase (1.14.14.96)
methyltetrahydroprotoberberine 14-monooxygenase (1.14.14.97)
protopine 6-monooxygenase (1.14.14.98)
(S)-limonene 3-monooxygenase (1.14.14.99)
dihydrosanguinarine 10-monooxygenase (1.14.14.100)
dihydrochelirubine 12-monooxygenase (1.14.14.101)
N-methylcoclaurine 3'-monooxygenase (1.14.14.102)
tabersonine 16-hydroxylase (1.14.14.103)
vinorine hydroxylase (1.14.14.104)
taxane 10beta-hydroxylase (1.14.14.105)
taxane 13alpha-hydroxylase (1.14.14.106)
ent-kaurenoic acid monooxygenase (1.14.14.107)
2,5-diketocamphane 1,2-monooxygenase (1.14.14.108)
3-hydroxyindolin-2-one monooxygenase (1.14.14.109)
2-hydroxy-1,4-benzoxazin-3-one monooxygenase (1.14.14.110)
9beta-pimara-7,15-diene oxidase (1.14.14.111)
ent-cassa-12,15-diene 11-hydroxylase (1.14.14.112)
alpha-humulene 10-hydroxylase (1.14.14.113)
amorpha-4,11-diene 12-monooxygenase (1.14.14.114)
11-oxo-beta-amyrin 30-oxidase (1.14.14.115)
averantin hydroxylase (1.14.14.116)
aflatoxin B synthase (1.14.14.117)
tryprostatin B 6-hydroxylase (1.14.14.118)
fumitremorgin C monooxygenase (1.14.14.119)
dammarenediol 12-hydroxylase (1.14.14.120)
protopanaxadiol 6-hydroxylase (1.14.14.121)
oryzalexin E synthase (1.14.14.122)
oryzalexin D synthase (1.14.14.123)
dihydromonacolin L hydroxylase (1.14.14.124)
monacolin L hydroxylase (1.14.14.125)
beta-amyrin 28-monooxygenase (1.14.14.126)
methyl farnesoate epoxidase (1.14.14.127)
farnesoate epoxidase (1.14.14.128)
long-chain acyl-CoA omega-monooxygenase (1.14.14.129)
laurate 7-monooxygenase (1.14.14.130)
bursehernin 5'-monooxygenase (1.14.14.131)
(-)-4'-demethyl-deoxypodophyllotoxin 4-hydroxylase (1.14.14.132)
1,8-cineole 2-endo-monooxygenase (1.14.14.133)
beta-amyrin 24-hydroxylase (1.14.14.134)
glyceollin synthase (1.14.14.135)
deoxysarpagine hydroxylase (1.14.14.136)
(+)-abscisic acid 8'-hydroxylase (1.14.14.137)
lithocholate 6beta-hydroxylase (1.14.14.138)
5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase (1.14.14.139)
licodione synthase (1.14.14.140)
psoralen synthase (1.14.14.141)
8-dimethylallylnaringenin 2'-hydroxylase (1.14.14.142)
(+)-menthofuran synthase (1.14.14.143)
abieta-7,13-diene hydroxylase (1.14.14.144)
abieta-7,13-dien-18-ol hydroxylase (1.14.14.145)
geranylgeraniol 18-hydroxylase (1.14.14.146)
22alpha-hydroxysteroid 23-monooxygenase (1.14.14.147)
angelicin synthase (1.14.14.148)
5-epiaristolochene 1,3-dihydroxylase (1.14.14.149)
costunolide synthase (1.14.14.150)
premnaspirodiene oxygenase (1.14.14.151)
beta-amyrin 11-oxidase (1.14.14.152)
indole-2-monooxygenase (1.14.14.153)
sterol 14alpha-demethylase (1.14.14.154)
3,6-diketocamphane 1,2-monooxygenase (1.14.14.155)
tryptophan N-monooxygenase (1.14.14.156)
indolin-2-one monooxygenase (1.14.14.157)
carotenoid epsilon hydroxylase (1.14.14.158)
dolabradiene monooxygenase (1.14.14.159)
zealexin A1 synthase (1.14.14.160)
nepetalactol monooxygenase (1.14.14.161)
flavanone 2-hydroxylase (1.14.14.162)
(S)-1-hydroxy-N-methylcanadine 13-hydroxylase (1.14.14.163)
fraxetin 5-hydroxylase (1.14.14.164)
indole-3-carbonyl nitrile 4-hydroxylase (1.14.14.165)
(S)-N-methylcanadine 1-hydroxylase (1.14.14.166)
(13S,14R)-13-O-acetyl-1-hydroxy-N-methylcanadine 8-hydroxylase (1.14.14.167)
germacrene A acid 8beta-hydroxylase (1.14.14.168)
eupatolide synthase (1.14.14.169)
8-epi-inunolide synthase (1.14.14.170)
beta-amyrin 16alpha-hydroxylase (1.14.14.171)
3,5,6-trichloropyridin-2-ol monooxygenase (1.14.14.172)
2,4,6-trichlorophenol monooxygenase (1.14.14.173)
geranylhydroquinone 3''-hydroxylase (1.14.14.174)
ferruginol synthase (1.14.14.175)
taxadiene 5alpha-hydroxylase (1.14.14.176)
ultra-long-chain fatty acid omega-hydroxylase (1.14.14.177)
steroid 22S-hydroxylase (1.14.14.178)
brassinosteroid 6-oxygenase (1.14.14.179)
brassinolide synthase (1.14.14.180)
sulfoquinovose monooxygenase (1.14.14.181)
taxoid 7beta-hydroxylase (1.14.14.182)
taxoid 2alpha-hydroxylase (1.14.14.183)
camphor 5-monooxygenase (1.14.15.1)
camphor 1,2-monooxygenase (1.14.15.2)
alkane 1-monooxygenase (1.14.15.3)
steroid 11beta-monooxygenase (1.14.15.4)
corticosterone 18-monooxygenase (1.14.15.5)
cholesterol monooxygenase (side-chain-cleaving) (1.14.15.6)
choline monooxygenase (1.14.15.7)
steroid 15beta-monooxygenase (1.14.15.8)
spheroidene monooxygenase (1.14.15.9)
(+)-camphor 6-endo-hydroxylase (1.14.15.10)
pentalenic acid synthase (1.14.15.11)
pimeloyl-[acyl-carrier protein] synthase (1.14.15.12)
pulcherriminic acid synthase (1.14.15.13)
methyl-branched lipid omega-hydroxylase (1.14.15.14)
cholestanetriol 26-monooxygenase (1.14.15.15)
vitamin D3 24-hydroxylase (1.14.15.16)
pheophorbide a oxygenase (1.14.15.17)
calcidiol 1-monooxygenase (1.14.15.18)
C-19 steroid 1alpha-hydroxylase (1.14.15.19)
heme oxygenase (biliverdin-producing, ferredoxin) (1.14.15.20)
zeaxanthin epoxidase (1.14.15.21)
vitamin D 1,25-hydroxylase (1.14.15.22)
chloroacetanilide N-alkylformylase (1.14.15.23)
beta-carotene 3-hydroxylase (1.14.15.24)
p-cymene methyl-monooxygenase (1.14.15.25)
toluene methyl-monooxygenase (1.14.15.26)
beta-dihydromenaquinone-9 omega-hydroxylase (1.14.15.27)
cholest-4-en-3-one 26-monooxygenase [(25R)-3-oxocholest-4-en-26-oate forming] (1.14.15.28)
cholest-4-en-3-one 26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming] (1.14.15.29)
3-ketosteroid 9alpha-monooxygenase (1.14.15.30)
2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase (1.14.15.31)
pentalenene oxygenase (1.14.15.32)
pikromycin synthase (1.14.15.33)
20-oxo-5-O-mycaminosyltylactone 23-monooxygenase (1.14.15.34)
6-deoxyerythronolide B hydroxylase (1.14.15.35)
sterol 14alpha-demethylase (ferredoxin) (1.14.15.36)
luteothin monooxygenase (1.14.15.37)
N,N-dimethyl phenylurea N-demethylase (1.14.15.38)
epi-isozizaene 5-monooxygenase (1.14.15.39)
phenylalanine 4-monooxygenase (1.14.16.1)
tyrosine 3-monooxygenase (1.14.16.2)
anthranilate 3-monooxygenase (1.14.16.3)
tryptophan 5-monooxygenase (1.14.16.4)
alkylglycerol monooxygenase (1.14.16.5)
mandelate 4-monooxygenase (1.14.16.6)
phenylalanine 3-monooxygenase (1.14.16.7)
dopamine beta-monooxygenase (1.14.17.1)
N-methylcoclaurine 3'-monooxygenase (ascorbate) (1.14.17.B1)
4-coumarate 3-monooxygenase (1.14.17.2)
peptidylglycine monooxygenase (1.14.17.3)
aminocyclopropanecarboxylate oxidase (1.14.17.4)
5,6-dihydroxyindole-2-carboxylic acid oxidase (1.14.18.B1)
tyrosinase (1.14.18.1)
CMP-N-acetylneuraminate monooxygenase (1.14.18.2)
methane monooxygenase (particulate) (1.14.18.3)
phosphatidylcholine 12-monooxygenase (1.14.18.4)
sphingolipid C4-monooxygenase (1.14.18.5)
4-hydroxysphinganine ceramide fatty acyl 2-hydroxylase (1.14.18.6)
dihydroceramide fatty acyl 2-hydroxylase (1.14.18.7)
7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase (1.14.18.8)
4alpha-methylsterol monooxygenase (1.14.18.9)
plant 4,4-dimethylsterol C-4alpha-methyl-monooxygenase (1.14.18.10)
plant 4alpha-monomethylsterol monooxygenase (1.14.18.11)
2-hydroxy fatty acid dioxygenase (1.14.18.12)
stearoyl-CoA 9-desaturase (1.14.19.1)
stearoyl-[acyl-carrier-protein] 9-desaturase (1.14.19.2)
acyl-CoA 6-desaturase (1.14.19.3)
acyl-lipid (11-3)-desaturase (1.14.19.4)
acyl-CoA 11-(Z)-desaturase (1.14.19.5)
acyl-CoA (9+3)-desaturase (1.14.19.6)
(S)-2-hydroxypropylphosphonic acid epoxidase (1.14.19.7)
pentalenolactone synthase (1.14.19.8)
[peptidyl-carrier-protein SgcC2]-(3S)-beta-tyrosyl thioester 3-halogenase (1.14.19.B8)
cis-DELTA13 desaturase (1.14.19.B9)
tryptophan 7-halogenase (1.14.19.9)
icosanoyl-CoA 5-desaturase (1.14.19.10)
indole 3-halogenase (1.14.19.B10)
acyl-[acyl-carrier-protein] 4-desaturase (1.14.19.11)
acyl-lipid omega-(9-4) desaturase (1.14.19.12)
acyl-CoA 15-desaturase (1.14.19.13)
linoleoyl-lipid DELTA9 conjugase (1.14.19.14)
(11Z)-hexadec-11-enoyl-CoA conjugase (1.14.19.15)
linoleoyl-lipid DELTA12 conjugase (11E,13Z-forming) (1.14.19.16)
sphingolipid 4-desaturase (1.14.19.17)
sphingolipid 8-(E)-desaturase (1.14.19.18)
sphingolipid 10-desaturase (1.14.19.19)
DELTA7-sterol 5(6)-desaturase (1.14.19.20)
cholesterol 7-desaturase (1.14.19.21)
acyl-lipid omega-6 desaturase (cytochrome b5) (1.14.19.22)
acyl-lipid (n+3)-(Z)-desaturase (ferredoxin) (1.14.19.23)
acyl-CoA 11-(E)-desaturase (1.14.19.24)
acyl-lipid omega-3 desaturase (cytochrome b5) (1.14.19.25)
acyl-[acyl-carrier-protein] 6-desaturase (1.14.19.26)
sn-2 palmitoyl-lipid 9-desaturase (1.14.19.27)
sn-1 stearoyl-lipid 9-desaturase (1.14.19.28)
sphingolipid 8-(E/Z)-desaturase (1.14.19.29)
acyl-lipid (8-3)-desaturase (1.14.19.30)
acyl-lipid (7-3)-desaturase (1.14.19.31)
palmitoyl-CoA 14-(E/Z)-desaturase (1.14.19.32)
DELTA12 acyl-lipid conjugase (11E,13E-forming) (1.14.19.33)
acyl-lipid (9+3)-(E)-desaturase (1.14.19.34)
sn-2 acyl-lipid omega-3 desaturase (ferredoxin) (1.14.19.35)
sn-1 acyl-lipid omega-3 desaturase (ferredoxin) (1.14.19.36)
acyl-CoA 5-desaturase (1.14.19.37)
acyl-lipid DELTA6-acetylenase (1.14.19.38)
acyl-lipid DELTA12-acetylenase (1.14.19.39)
hex-5-enoyl-[acyl-carrier protein] acetylenase (1.14.19.40)
sterol 22-desaturase (1.14.19.41)
palmitoyl-[glycerolipid] 7-desaturase (1.14.19.42)
palmitoyl-[glycerolipid] 3-(E)-desaturase (1.14.19.43)
acyl-CoA (8-3)-desaturase (1.14.19.44)
sn-1 oleoyl-lipid 12-desaturase (1.14.19.45)
sn-1 linoleoyl-lipid 6-desaturase (1.14.19.46)
acyl-lipid (9-3)-desaturase (1.14.19.47)
tert-amyl alcohol desaturase (1.14.19.48)
tetracycline 7-halogenase (1.14.19.49)
noroxomaritidine synthase (1.14.19.50)
(S)-corytuberine synthase (1.14.19.51)
camalexin synthase (1.14.19.52)
all-trans-retinol 3,4-desaturase (1.14.19.53)
1,2-dehydroreticuline synthase (1.14.19.54)
4-hydroxybenzoate brominase (decarboxylating) (1.14.19.55)
1H-pyrrole-2-carbonyl-[peptidyl-carrier protein] chlorinase (1.14.19.56)
1H-pyrrole-2-carbonyl-[peptidyl-carrier protein] brominase (1.14.19.57)
tryptophan 5-halogenase (1.14.19.58)
tryptophan 6-halogenase (1.14.19.59)
7-chloro-L-tryptophan 6-halogenase (1.14.19.60)
dihydrorhizobitoxine desaturase (1.14.19.61)
secologanin synthase (1.14.19.62)
pseudobaptigenin synthase (1.14.19.63)
(S)-stylopine synthase (1.14.19.64)
(S)-cheilanthifoline synthase (1.14.19.65)
berbamunine synthase (1.14.19.66)
salutaridine synthase (1.14.19.67)
(S)-canadine synthase (1.14.19.68)
biflaviolin synthase (1.14.19.69)
mycocyclosin synthase (1.14.19.70)
fumitremorgin C synthase (1.14.19.71)
(-)-pluviatolide synthase (1.14.19.72)
(S)-nandinine synthase (1.14.19.73)
(+)-piperitol/(+)-sesamin synthase (1.14.19.74)
very-long-chain acyl-lipid omega-9 desaturase (1.14.19.75)
flavone synthase II (1.14.19.76)
plasmanylethanolamine desaturase (1.14.19.77)
decanoyl-[acyl-carrier protein] acetylenase (1.14.19.78)
3beta,22alpha-dihydroxysteroid 3-dehydrogenase (1.14.19.79)
deacetoxycephalosporin-C synthase (1.14.20.1)
2,4-dihydroxy-1,4-benzoxazin-3-one-glucoside dioxygenase (1.14.20.2)
(5R)-carbapenem-3-carboxylate synthase (1.14.20.3)
cycloclavine dioxygenase (alternatively: multifunctional dioxygenase EasH) (1.14.20.B3)
anthocyanidin synthase (1.14.20.4)
preaustinoid dioxygenase (1.14.20.B4)
flavone synthase I (1.14.20.5)
flavonol synthase (1.14.20.6)
2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming) (1.14.20.7)
(-)-deoxypodophyllotoxin synthase (1.14.20.8)
L-tyrosine isonitrile desaturase (1.14.20.9)
L-tyrosine isonitrile desaturase/decarboxylase (1.14.20.10)
3-[(Z)-2-isocyanoethenyl]-1H-indole synthase (1.14.20.11)
3-[(E)-2-isocyanoethenyl]-1H-indole synthase (1.14.20.12)
6beta-hydroxyhyoscyamine epoxidase (1.14.20.13)
hapalindole-type alkaloid chlorinase (1.14.20.14)
L-threonyl-[L-threonyl-carrier protein] 4-chlorinase (1.14.20.15)
(E,E)-geranyllinalool oxidase (1.14.21.B1)
(S)-stylopine synthase (1.14.21.1)
(S)-cheilanthifoline synthase (1.14.21.2)
berbamunine synthase (1.14.21.3)
salutaridine synthase (1.14.21.4)
(S)-canadine synthase (1.14.21.5)
lathosterol oxidase (1.14.21.6)
biflaviolin synthase (1.14.21.7)
pseudobaptigenin synthase (1.14.21.8)
mycocyclosin synthase (1.14.21.9)
fumitremorgin C synthase (1.14.21.10)
(–)-pluviatolide synthase (1.14.21.11)
(S)-nandinine synthase (1.14.21.12)
campesterol 22-hydroxylase (1.14.99.B1)
prostaglandin-endoperoxide synthase (1.14.99.1)
kynurenine 7,8-hydroxylase (1.14.99.2)
heme oxygenase (biliverdin-producing) (1.14.99.3)
2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinone hydroxylase (1.14.99.B4)
progesterone monooxygenase (1.14.99.4)
2-octaprenyl-6-methoxyphenol hydroxylase (1.14.99.B5)
stearoyl-CoA desaturase (1.14.99.5)
acyl-[acyl-carrier-protein] desaturase (1.14.99.6)
squalene monooxygenase (1.14.99.7)
arene monooxygenase (epoxidizing) (1.14.99.8)
steroid 17alpha-monooxygenase (1.14.99.9)
lytic xyloglucan monooxygenase (1.14.99.B10)
steroid 21-monooxygenase (1.14.99.10)
estradiol 6beta-monooxygenase (1.14.99.11)
precorrin-3B synthase (anaerobic) (1.14.99.B11)
androst-4-ene-3,17-dione monooxygenase (1.14.99.12)
3-hydroxybenzoate 4-monooxygenase (1.14.99.13)
progesterone 11alpha-monooxygenase (1.14.99.14)
4-methoxybenzoate monooxygenase (O-demethylating) (1.14.99.15)
methylsterol monooxygenase (1.14.99.16)
glyceryl-ether monooxygenase (1.14.99.17)
CMP-N-acetylneuraminate monooxygenase (1.14.99.18)
plasmanylethanolamine desaturase (1.14.99.19)
phylloquinone monooxygenase (2,3-epoxidizing) (1.14.99.20)
Latia-luciferin monooxygenase (demethylating) (1.14.99.21)
ecdysone 20-monooxygenase (1.14.99.22)
3-hydroxybenzoate 2-monooxygenase (1.14.99.23)
steroid 9alpha-monooxygenase (1.14.99.24)
linoleoyl-CoA desaturase (1.14.99.25)
2-hydroxypyridine 5-monooxygenase (1.14.99.26)
juglone 3-monooxygenase (1.14.99.27)
linalool 8-monooxygenase (1.14.99.28)
deoxyhypusine monooxygenase (1.14.99.29)
carotene 7,8-desaturase (1.14.99.30)
myristoyl-CoA 11-(E) desaturase (1.14.99.31)
myristoyl-CoA 11-(Z) desaturase (1.14.99.32)
DELTA12-fatty acid dehydrogenase (1.14.99.33)
monoprenyl isoflavone epoxidase (1.14.99.34)
thiophene-2-carbonyl-CoA monooxygenase (1.14.99.35)
beta-carotene 15,15'-monooxygenase (1.14.99.36)
taxadiene 5alpha-hydroxylase (1.14.99.37)
cholesterol 25-monooxygenase (1.14.99.38)
ammonia monooxygenase (1.14.99.39)
5,6-dimethylbenzimidazole synthase (1.14.99.40)
all-trans-8'-apo-beta-carotenal 15,15'-oxygenase (1.14.99.41)
zeaxanthin 7,8-dioxygenase (1.14.99.42)
beta-amyrin 24-hydroxylase (1.14.99.43)
diapolycopene oxygenase (1.14.99.44)
carotene epsilon-monooxygenase (1.14.99.45)
pyrimidine oxygenase (1.14.99.46)
(+)-larreatricin hydroxylase (1.14.99.47)
heme oxygenase (staphylobilin-producing) (1.14.99.48)
2-hydroxy-5-methyl-1-naphthoate 7-hydroxylase (1.14.99.49)
gamma-glutamyl hercynylcysteine S-oxide synthase (1.14.99.50)
hercynylcysteine S-oxide synthase (1.14.99.51)
L-cysteinyl-L-histidinylsulfoxide synthase (1.14.99.52)
lytic chitin monooxygenase (1.14.99.53)
lytic cellulose monooxygenase (C1-hydroxylating) (1.14.99.54)
lytic starch monooxygenase (1.14.99.55)
lytic cellulose monooxygenase (C4-dehydrogenating) (1.14.99.56)
heme oxygenase (mycobilin-producing) (1.14.99.57)
heme oxygenase (biliverdin-IX-beta and delta-forming) (1.14.99.58)
tryptamine 4-monooxygenase (1.14.99.59)
3-demethoxyubiquinol 3-hydroxylase (1.14.99.60)
cyclooctat-9-en-7-ol 5-monooxygenase (1.14.99.61)
cyclooctatin synthase (1.14.99.62)
beta-carotene 4-ketolase (1.14.99.63)
zeaxanthin 4-ketolase (1.14.99.64)
4-amino-L-phenylalanyl-[CmlP-peptidyl-carrier-protein] 3-hydroxylase (1.14.99.65)
[histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase (1.14.99.66)
alpha-N-dichloroacetyl-p-aminophenylserinol N-oxygenase (1.14.99.67)
4-aminobenzoate N-oxygenase (1.14.99.68)
tRNA 2-(methylsulfanyl)-N6-isopentenyladenosine37 hydroxylase (1.14.99.69)
superoxide dismutase (1.15.1.1)
superoxide reductase (1.15.1.2)
mercury(II) reductase (1.16.1.1)
diferric-transferrin reductase (1.16.1.2)
aquacobalamin reductase (1.16.1.3)
cob(II)alamin reductase (1.16.1.4)
aquacobalamin reductase (NADPH) (1.16.1.5)
cyanocobalamin reductase (1.16.1.6)
ferric-chelate reductase (NADH) (1.16.1.7)
[methionine synthase] reductase (1.16.1.8)
ferric-chelate reductase (NADPH) (1.16.1.9)
ferric-chelate reductase [NAD(P)H] (1.16.1.10)
ferroxidase (1.16.3.1)
bacterial non-heme ferritin (1.16.3.2)
manganese oxidase (1.16.3.3)
cuproxidase (1.16.3.4)
ascorbate ferrireductase (transmembrane) (1.16.5.1)
cob(II)yrinic acid a,c-diamide reductase (1.16.8.1)
iron:rusticyanin reductase (1.16.9.1)
iron:rusticyanin reductase (1.16.98.1)
mitochondrial amidoxime reducing component (1.16.98.B1)
[Co(II) methylated amine-specific corrinoid protein] reductase (1.16.99.1)
CDP-4-dehydro-6-deoxyglucose reductase (1.17.1.1)
4-hydroxy-3-methylbut-2-enyl diphosphate reductase (1.17.1.2)
leucoanthocyanidin reductase (1.17.1.3)
xanthine dehydrogenase (1.17.1.4)
nicotinate dehydrogenase (1.17.1.5)
bile-acid 7alpha-dehydroxylase (1.17.1.6)
3-oxo-5,6-dehydrosuberyl-CoA semialdehyde dehydrogenase (1.17.1.7)
4-hydroxy-tetrahydrodipicolinate reductase (1.17.1.8)
formate dehydrogenase (1.17.1.9)
formate dehydrogenase (NADP+) (1.17.1.10)
formate dehydrogenase (NAD+, ferredoxin) (1.17.1.11)
nicotinate dehydrogenase (cytochrome) (1.17.2.1)
lupanine 17-hydroxylase (cytochrome c) (1.17.2.2)
formate dehydrogenase (cytochrome-c-553) (1.17.2.3)
pteridine oxidase (1.17.3.1)
xanthine oxidase (1.17.3.2)
6-hydroxynicotinate dehydrogenase (1.17.3.3)
juglone 3-hydroxylase (1.17.3.4)
ribonucleoside-diphosphate reductase (1.17.4.1)
ribonucleoside-triphosphate reductase (thioredoxin) (1.17.4.2)
4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (1.17.4.3)
vitamin-K-epoxide reductase (warfarin-sensitive) (1.17.4.4)
vitamin-K-epoxide reductase (warfarin-insensitive) (1.17.4.5)
phenylacetyl-CoA dehydrogenase (1.17.5.1)
caffeine dehydrogenase (1.17.5.2)
carotenoid ketolase (quinone) (1.17.5.B2)
formate dehydrogenase-N (1.17.5.3)
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin) (1.17.7.1)
7-hydroxymethyl chlorophyll a reductase (1.17.7.2)
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) (1.17.7.3)
4-hydroxy-3-methylbut-2-en-1-yl diphosphate reductase (1.17.7.4)
hydroxysqualene dehydroxylase (1.17.8.1)
4-methylphenol dehydrogenase (hydroxylating) (1.17.9.1)
(+)-pinoresinol hydroxylase (1.17.9.2)
bile-acid 7alpha-dehydroxylase (1.17.98.1)
bacteriochlorophyllide c C-71-hydroxylase (1.17.98.2)
formate dehydrogenase (coenzyme F420) (1.17.98.3)
formate dehydrogenase (hydrogenase) (1.17.98.4)
4-methylphenol dehydrogenase (hydroxylating) (1.17.99.1)
ethylbenzene hydroxylase (1.17.99.2)
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA 24-hydroxylase (1.17.99.3)
uracil/thymine dehydrogenase (1.17.99.4)
bile-acid 7alpha-dehydroxylase (1.17.99.5)
epoxyqueuosine reductase (1.17.99.6)
formate dehydrogenase (acceptor) (1.17.99.7)
limonene dehydrogenase (1.17.99.8)
heme a synthase (1.17.99.9)
steroid C-25 hydroxylase (1.17.99.10)
3-oxo-DELTA1-steroid hydratase/dehydrogenase (1.17.99.11)
rubredoxin-NAD+ reductase (1.18.1.1)
ferredoxin-NADP+ reductase (1.18.1.2)
ferredoxin-NAD+ reductase (1.18.1.3)
rubredoxin-NAD(P)+ reductase (1.18.1.4)
putidaredoxin-NAD+ reductase (1.18.1.5)
adrenodoxin-NADP+ reductase (1.18.1.6)
ferredoxin-NAD(P)+ reductase (naphthalene dioxygenase ferredoxin-specific) (1.18.1.7)
ferredoxin-NAD+ oxidoreductase (Na+-transporting) (1.18.1.8)
hydrogenase (1.18.3.1)
nitrogenase (1.18.6.1)
vanadium-dependent nitrogenase (1.18.6.2)
superoxide reductase (1.18.96.1)
hydrogenase (1.18.99.1)
flavodoxin-NADP+ reductase (1.19.1.1)
nitrogenase (flavodoxin) (1.19.6.1)
phosphonate dehydrogenase (1.20.1.1)
arsenate reductase (cytochrome c) (1.20.2.1)
arsenate reductase (glutathione/glutaredoxin) (1.20.4.1)
methylarsonate reductase (1.20.4.2)
mycoredoxin (1.20.4.3)
arsenate reductase (thioredoxin) (1.20.4.4)
arsenate reductase (azurin) (1.20.9.1)
arsenate reductase (azurin) (1.20.98.1)
arsenate reductase (donor) (1.20.99.1)
iodotyrosine deiodinase (1.21.1.1)
2,4-dichlorobenzoyl-CoA reductase (1.21.1.2)
isopenicillin-N synthase (1.21.3.1)
columbamine oxidase (1.21.3.2)
reticuline oxidase (1.21.3.3)
sulochrin oxidase [(+)-bisdechlorogeodin-forming] (1.21.3.4)
sulochrin oxidase [(-)-bisdechlorogeodin-forming] (1.21.3.5)
aureusidin synthase (1.21.3.6)
tetrahydrocannabinolic acid synthase (1.21.3.7)
cannabidiolic acid synthase (1.21.3.8)
dichlorochromopyrrolate synthase (1.21.3.9)
hercynylcysteine S-oxide synthase (1.21.3.10)
D-proline reductase (1.21.4.1)
glycine reductase (1.21.4.2)
sarcosine reductase (1.21.4.3)
betaine reductase (1.21.4.4)
tetrachlorohydroquinone reductive dehalogenase (1.21.4.5)
cyclic dehypoxanthinyl futalosine synthase (1.21.98.1)
dichlorochromopyrrolate synthase (1.21.98.2)
anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase (1.21.98.3)
PqqA peptide cyclase (1.21.98.4)
beta-cyclopiazonate dehydrogenase (1.21.99.1)
cyclic dehypoxanthinyl futalosine synthase (1.21.99.2)
thyroxine 5-deiodinase (1.21.99.3)
thyroxine 5'-deiodinase (1.21.99.4)
tetrachloroethene reductive dehalogenase (1.21.99.5)
iodotyrosine deiodinase (1.22.1.1)
(+)-pinoresinol reductase (1.23.1.1)
(+)-lariciresinol reductase (1.23.1.2)
(-)-pinoresinol reductase (1.23.1.3)
(-)-lariciresinol reductase (1.23.1.4)
violaxanthin de-epoxidase (1.23.5.1)
chlorate reductase (1.97.1.1)
iodate reductase (1.97.1.B1)
pyrogallol hydroxytransferase (1.97.1.2)
sulfur reductase (1.97.1.3)
[formate-C-acetyltransferase]-activating enzyme (1.97.1.4)
arsenate reductase (glutaredoxin) (1.97.1.5)
arsenate reductase (donor) (1.97.1.6)
methylarsonate reductase (1.97.1.7)
tetrachloroethene reductive dehalogenase (1.97.1.8)
selenate reductase (1.97.1.9)
thyroxine 5'-deiodinase (1.97.1.10)
thyroxine 5-deiodinase (1.97.1.11)
photosystem I (1.97.1.12)
nicotinamide N-methyltransferase (2.1.1.1)
guanidinoacetate N-methyltransferase (2.1.1.2)
sialate-8-O-methyltransferase (2.1.1.B3)
thetin-homocysteine S-methyltransferase (2.1.1.3)
acetylserotonin O-methyltransferase (2.1.1.4)
betaine-homocysteine S-methyltransferase (2.1.1.5)
catechol O-methyltransferase (2.1.1.6)
nicotinate N-methyltransferase (2.1.1.7)
histamine N-methyltransferase (2.1.1.8)
thiol S-methyltransferase (2.1.1.9)
homocysteine S-methyltransferase (2.1.1.10)
magnesium protoporphyrin IX methyltransferase (2.1.1.11)
methionine S-methyltransferase (2.1.1.12)
methionine synthase (2.1.1.13)
5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase (2.1.1.14)
fatty-acid O-methyltransferase (2.1.1.15)
methylene-fatty-acyl-phospholipid synthase (2.1.1.16)
phosphatidylethanolamine N-methyltransferase (2.1.1.17)
polysaccharide O-methyltransferase (2.1.1.18)
trimethylsulfonium-tetrahydrofolate N-methyltransferase (2.1.1.19)
glycine N-methyltransferase (2.1.1.20)
methylamine-glutamate N-methyltransferase (2.1.1.21)
carnosine N-methyltransferase (2.1.1.22)
protein-arginine N-methyltransferase (2.1.1.23)
protein-gamma-glutamate O-methyltransferase (2.1.1.24)
phenol O-methyltransferase (2.1.1.25)
iodophenol O-methyltransferase (2.1.1.26)
tyramine N-methyltransferase (2.1.1.27)
phenylethanolamine N-methyltransferase (2.1.1.28)
tRNA (cytosine-5-)-methyltransferase (2.1.1.29)
tRNA (purine-2- or -6-)-methyltransferase (2.1.1.30)
tRNA (guanine-N1-)-methyltransferase (2.1.1.31)
tRNA (guanine-N2-)-methyltransferase (2.1.1.32)
tRNA (guanine46-N7)-methyltransferase (2.1.1.33)
tRNA (guanosine18-2'-O)-methyltransferase (2.1.1.34)
tRNA (uracil54-C5)-methyltransferase (2.1.1.35)
tRNA (adenine-N1-)-methyltransferase (2.1.1.36)
DNA (cytosine-5-)-methyltransferase (2.1.1.37)
O-demethylpuromycin O-methyltransferase (2.1.1.38)
inositol 3-methyltransferase (2.1.1.39)
inositol 1-methyltransferase (2.1.1.40)
sterol 24-C-methyltransferase (2.1.1.41)
flavone 3'-O-methyltransferase (2.1.1.42)
histone-lysine N-methyltransferase (2.1.1.43)
tRNA (cytosine49-C5)-methyltransferase (2.1.1.B43)
L-histidine Nalpha-methyltransferase (2.1.1.44)
thymidylate synthase (2.1.1.45)
isoflavone 4'-O-methyltransferase (2.1.1.46)
indolepyruvate C-methyltransferase (2.1.1.47)
rRNA (adenine-N6-)-methyltransferase (2.1.1.48)
amine N-methyltransferase (2.1.1.49)
loganate O-methyltransferase (2.1.1.50)
rRNA (guanine-N1-)-methyltransferase (2.1.1.51)
rRNA (guanine-N2-)-methyltransferase (2.1.1.52)
putrescine N-methyltransferase (2.1.1.53)
deoxycytidylate C-methyltransferase (2.1.1.54)
tRNA (adenine-N6-)-methyltransferase (2.1.1.55)
mRNA (guanine-N7)-methyltransferase (2.1.1.56)
methyltransferase cap1 (2.1.1.57)
mRNA (adenosine-2'-O-)-methyltransferase (2.1.1.58)
[cytochrome c]-lysine N-methyltransferase (2.1.1.59)
calmodulin-lysine N-methyltransferase (2.1.1.60)
tRNA 5-(aminomethyl)-2-thiouridylate-methyltransferase (2.1.1.61)
mRNA (2'-O-methyladenosine-N6-)-methyltransferase (2.1.1.62)
methylated-DNA-[protein]-cysteine S-methyltransferase (2.1.1.63)
3-demethylubiquinol 3-O-methyltransferase (2.1.1.64)
licodione 2'-O-methyltransferase (2.1.1.65)
rRNA (adenosine-2'-O-)-methyltransferase (2.1.1.66)
thiopurine S-methyltransferase (2.1.1.67)
caffeate O-methyltransferase (2.1.1.68)
5-hydroxyfuranocoumarin 5-O-methyltransferase (2.1.1.69)
8-hydroxyfuranocoumarin 8-O-methyltransferase (2.1.1.70)
phosphatidyl-N-methylethanolamine N-methyltransferase (2.1.1.71)
site-specific DNA-methyltransferase (adenine-specific) (2.1.1.72)
site-specific DNA-methyltransferase (cytosine-specific) (2.1.1.73)
apigenin 7-O-methyltransferase (2.1.1.B74)
methylenetetrahydrofolate-tRNA-(uracil54-C5)-methyltransferase [NAD(P)H-oxidizing] (2.1.1.74)
apigenin 4'-O-methyltransferase (2.1.1.75)
flavonoid 7-O-methyltransferase (2.1.1.B75)
flavone/flavonol 7-O-methyltransferase (2.1.1.B76)
quercetin 3-O-methyltransferase (2.1.1.76)
protein-L-isoaspartate(D-aspartate) O-methyltransferase (2.1.1.77)
isoorientin 3'-O-methyltransferase (2.1.1.78)
cyclopropane-fatty-acyl-phospholipid synthase (2.1.1.79)
protein-glutamate O-methyltransferase (2.1.1.80)
nicotine N-methyltransferase (2.1.1.81)
3-methylquercetin 7-O-methyltransferase (2.1.1.82)
3,7-dimethylquercetin 4'-O-methyltransferase (2.1.1.83)
7'-O-demethylcephaeline 6',7'-dimethyltransferase (2.1.1.B83)
cephaline 6'-O-methyltransferase (2.1.1.B84)
methylquercetagetin 6-O-methyltransferase (2.1.1.84)
7'-O-demethylcephaline methyltransferase (2.1.1.B85)
protein-histidine N-methyltransferase (2.1.1.85)
tetrahydromethanopterin S-methyltransferase (2.1.1.86)
pyridine N-methyltransferase (2.1.1.87)
8-hydroxyquercetin 8-O-methyltransferase (2.1.1.88)
tetrahydrocolumbamine 2-O-methyltransferase (2.1.1.89)
methanol-corrinoid protein Co-methyltransferase (2.1.1.90)
isobutyraldoxime O-methyltransferase (2.1.1.91)
bergaptol O-methyltransferase (2.1.1.92)
xanthotoxol O-methyltransferase (2.1.1.93)
tabersonine 16-O-methyltransferase (2.1.1.94)
tocopherol C-methyltransferase (2.1.1.95)
thioether S-methyltransferase (2.1.1.96)
3-hydroxyanthranilate 4-C-methyltransferase (2.1.1.97)
diphthine synthase (2.1.1.98)
3-hydroxy-16-methoxy-2,3-dihydrotabersonine N-methyltransferase (2.1.1.99)
protein-S-isoprenylcysteine O-methyltransferase (2.1.1.100)
macrocin O-methyltransferase (2.1.1.101)
demethylmacrocin O-methyltransferase (2.1.1.102)
phosphoethanolamine N-methyltransferase (2.1.1.103)
caffeoyl-CoA O-methyltransferase (2.1.1.104)
N-benzoyl-4-hydroxyanthranilate 4-O-methyltransferase (2.1.1.105)
tryptophan 2-C-methyltransferase (2.1.1.106)
uroporphyrinogen-III C-methyltransferase (2.1.1.107)
6-hydroxymellein O-methyltransferase (2.1.1.108)
demethylsterigmatocystin 6-O-methyltransferase (2.1.1.109)
tRNA (cytosine32-N3)-methyltransferase (2.1.1.B109)
sterigmatocystin 8-O-methyltransferase (2.1.1.110)
anthranilate N-methyltransferase (2.1.1.111)
archaeal lysine methyltransferase 4 (2.1.1.B112)
glucuronoxylan 4-O-methyltransferase (2.1.1.112)
site-specific DNA-methyltransferase (cytosine-N4-specific) (2.1.1.113)
SuaI restriction-modification system (2.1.1.B113)
M.PabI methyltransferase (2.1.1.B114)
polyprenyldihydroxybenzoate methyltransferase (2.1.1.114)
(RS)-1-benzyl-1,2,3,4-tetrahydroisoquinoline N-methyltransferase (2.1.1.115)
3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase (2.1.1.116)
(S)-scoulerine 9-O-methyltransferase (2.1.1.117)
methylentetrahydrofolate-tRNA-(uracil1939-C5)-methyltransferase (FADH2-oxidizing) (2.1.1.B117)
columbamine O-methyltransferase (2.1.1.118)
sterol 4-C-methyltransferase (2.1.1.B118)
10-hydroxydihydrosanguinarine 10-O-methyltransferase (2.1.1.119)
nicotinic acid methyltransferase (2.1.1.B119)
12-hydroxydihydrochelirubine 12-O-methyltransferase (2.1.1.120)
gentamin X2 methyltransferase (2.1.1.B120)
6-O-methylnorlaudanosoline 5'-O-methyltransferase (2.1.1.121)
isoflavone 3'-O-methyltransferase (2.1.1.B121)
(S)-tetrahydroprotoberberine N-methyltransferase (2.1.1.122)
tRNA (adenine37)-methyltransferase (2.1.1.B122)
16S rRNA (uridine1369-2'-O)-methyltransferase (2.1.1.B123)
[cytochrome-c]-methionine S-methyltransferase (2.1.1.123)
16S rRNA (guanine1370-2'-O)-methyltransferase (2.1.1.B124)
[cytochrome c]-arginine N-methyltransferase (2.1.1.124)
16S rRNA (guanine1145-2'-O)-methyltransferase (2.1.1.B125)
histone-arginine N-methyltransferase (2.1.1.125)
4-methoxybenzoic acid carboxyl methyltransferase (2.1.1.B126)
[myelin basic protein]-arginine N-methyltransferase (2.1.1.126)
resveratrol 4'-O-methyltransferase (2.1.1.B127)
[ribulose-bisphosphate carboxylase]-lysine N-methyltransferase (2.1.1.127)
(RS)-norcoclaurine 6-O-methyltransferase (2.1.1.128)
28S rRNA (adenine1322-N1)-methyltransferase (2.1.1.B128)
inositol 4-methyltransferase (2.1.1.129)
precorrin-2 C20-methyltransferase (2.1.1.130)
[histone H3]-N-methyllysine9 N-methyltransferase (2.1.1.B130)
precorrin-3B C17-methyltransferase (2.1.1.131)
precorrin-6B C5,15-methyltransferase (decarboxylating) (2.1.1.132)
precorrin-4 C11-methyltransferase (2.1.1.133)
myo-inositol 6-O-methyltransferase (2.1.1.134)
[methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing) (2.1.1.135)
chlorophenol O-methyltransferase (2.1.1.136)
arsenite methyltransferase (2.1.1.137)
methylarsonite methyltransferase (2.1.1.138)
3'-demethylstaurosporine O-methyltransferase (2.1.1.139)
(S)-coclaurine-N-methyltransferase (2.1.1.140)
tRNAHis-specific 5'-phosphate monomethyltransferase (2.1.1.B140)
gamma-butyrobetaine-corrinoid-binding protein methyltransferase (2.1.1.B141)
jasmonate O-methyltransferase (2.1.1.141)
cycloartenol 24-C-methyltransferase (2.1.1.142)
24-methylenesterol C-methyltransferase (2.1.1.143)
trans-aconitate 2-methyltransferase (2.1.1.144)
trans-aconitate 3-methyltransferase (2.1.1.145)
(iso)eugenol O-methyltransferase (2.1.1.146)
corydaline synthase (2.1.1.147)
thymidylate synthase (FAD) (2.1.1.148)
myricetin O-methyltransferase (2.1.1.149)
isoflavone 7-O-methyltransferase (2.1.1.150)
cobalt-factor II C20-methyltransferase (2.1.1.151)
precorrin-6A synthase (deacetylating) (2.1.1.152)
vitexin 2''-O-rhamnoside 7-O-methyltransferase (2.1.1.153)
isoliquiritigenin 2'-O-methyltransferase (2.1.1.154)
kaempferol 4'-O-methyltransferase (2.1.1.155)
glycine/sarcosine N-methyltransferase (2.1.1.156)
sarcosine/dimethylglycine N-methyltransferase (2.1.1.157)
7-methylxanthosine synthase (2.1.1.158)
theobromine synthase (2.1.1.159)
caffeine synthase (2.1.1.160)
dimethylglycine N-methyltransferase (2.1.1.161)
glycine/sarcosine/dimethylglycine N-methyltransferase (2.1.1.162)
demethylmenaquinone methyltransferase (2.1.1.163)
demethylrebeccamycin-D-glucose O-methyltransferase (2.1.1.164)
methyl halide transferase (2.1.1.165)
23S rRNA (uridine2552-2'-O)-methyltransferase (2.1.1.166)
27S pre-rRNA (guanosine2922-2'-O)-methyltransferase (2.1.1.167)
21S rRNA (uridine2791-2'-O)-methyltransferase (2.1.1.168)
tricetin 3',4',5'-O-trimethyltransferase (2.1.1.169)
16S rRNA (guanine527-N7)-methyltransferase (2.1.1.170)
16S rRNA (guanine966-N2)-methyltransferase (2.1.1.171)
16S rRNA (guanine1207-N2)-methyltransferase (2.1.1.172)
23S rRNA (guanine2445-N2)-methyltransferase (2.1.1.173)
23S rRNA (guanine1835-N2)-methyltransferase (2.1.1.174)
tricin synthase (2.1.1.175)
16S rRNA (cytosine967-C5)-methyltransferase (2.1.1.176)
23S rRNA (pseudouridine1915-N3)-methyltransferase (2.1.1.177)
16S rRNA (cytosine1407-C5)-methyltransferase (2.1.1.178)
16S rRNA (guanine1405-N7)-methyltransferase (2.1.1.179)
16S rRNA (adenine1408-N1)-methyltransferase (2.1.1.180)
23S rRNA (adenine1618-N6)-methyltransferase (2.1.1.181)
16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase (2.1.1.182)
18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase (2.1.1.183)
23S rRNA (adenine2085-N6)-dimethyltransferase (2.1.1.184)
23S rRNA (guanosine2251-2'-O)-methyltransferase (2.1.1.185)
23S rRNA (cytidine2498-2'-O)-methyltransferase (2.1.1.186)
23S rRNA (guanine745-N1)-methyltransferase (2.1.1.187)
23S rRNA (guanine748-N1)-methyltransferase (2.1.1.188)
23S rRNA (uracil747-C5)-methyltransferase (2.1.1.189)
23S rRNA (uracil1939-C5)-methyltransferase (2.1.1.190)
23S rRNA (cytosine1962-C5)-methyltransferase (2.1.1.191)
23S rRNA (adenine2503-C2)-methyltransferase (2.1.1.192)
16S rRNA (uracil1498-N3)-methyltransferase (2.1.1.193)
23S rRNA (adenine2503-C2,C8)-dimethyltransferase (2.1.1.194)
cobalt-precorrin-5B (C1)-methyltransferase (2.1.1.195)
cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating] (2.1.1.196)
malonyl-[acyl-carrier protein] O-methyltransferase (2.1.1.197)
16S rRNA (cytidine1402-2'-O)-methyltransferase (2.1.1.198)
16S rRNA (cytosine1402-N4)-methyltransferase (2.1.1.199)
tRNA (cytidine32/uridine32-2'-O)-methyltransferase (2.1.1.200)
2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (2.1.1.201)
multisite-specific tRNA:(cytosine-C5)-methyltransferase (2.1.1.202)
tRNA (cytosine34-C5)-methyltransferase (2.1.1.203)
tRNA (cytosine38-C5)-methyltransferase (2.1.1.204)
tRNA (cytidine32/guanosine34-2'-O)-methyltransferase (2.1.1.205)
tRNA (cytidine56-2'-O)-methyltransferase (2.1.1.206)
tRNA (cytidine34-2'-O)-methyltransferase (2.1.1.207)
23S rRNA (uridine2479-2'-O)-methyltransferase (2.1.1.208)
23S rRNA (guanine2535-N1)-methyltransferase (2.1.1.209)
demethylspheroidene O-methyltransferase (2.1.1.210)
tRNASer (uridine44-2'-O)-methyltransferase (2.1.1.211)
2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase (2.1.1.212)
tRNA (guanine10-N2)-dimethyltransferase (2.1.1.213)
tRNA (guanine10-N2)-methyltransferase (2.1.1.214)
tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase (2.1.1.215)
tRNA (guanine26-N2)-dimethyltransferase (2.1.1.216)
tRNA (adenine22-N1)-methyltransferase (2.1.1.217)
tRNA (adenine9-N1)-methyltransferase (2.1.1.218)
tRNA (adenine57-N1/adenine58-N1)-methyltransferase (2.1.1.219)
tRNA (adenine58-N1)-methyltransferase (2.1.1.220)
tRNA (guanine9-N1)-methyltransferase (2.1.1.221)
2-polyprenyl-6-hydroxyphenol methylase (2.1.1.222)
tRNA1Val (adenine37-N6)-methyltransferase (2.1.1.223)
23S rRNA (adenine2503-C8)-methyltransferase (2.1.1.224)
tRNA:m4X modification enzyme (2.1.1.225)
23S rRNA (cytidine1920-2'-O)-methyltransferase (2.1.1.226)
16S rRNA (cytidine1409-2'-O)-methyltransferase (2.1.1.227)
tRNA (guanine37-N1)-methyltransferase (2.1.1.228)
tRNA (carboxymethyluridine34-5-O)-methyltransferase (2.1.1.229)
23S rRNA (adenosine1067-2'-O)-methyltransferase (2.1.1.230)
flavonoid 4'-O-methyltransferase (2.1.1.231)
naringenin 7-O-methyltransferase (2.1.1.232)
[phosphatase 2A protein]-leucine-carboxy methyltransferase (2.1.1.233)
dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucopyranose N,N-dimethyltransferase (2.1.1.234)
dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose N,N-dimethyltransferase (2.1.1.235)
dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose N,N-dimethyltransferase (2.1.1.236)
mycinamicin III 3''-O-methyltransferase (2.1.1.237)
mycinamicin VI 2''-O-methyltransferase (2.1.1.238)
L-olivosyl-oleandolide 3-O-methyltransferase (2.1.1.239)
trans-resveratrol di-O-methyltransferase (2.1.1.240)
2,4,7-trihydroxy-1,4-benzoxazin-3-one-glucoside 7-O-methyltransferase (2.1.1.241)
16S rRNA (guanine1516-N2)-methyltransferase (2.1.1.242)
2-ketoarginine methyltransferase (2.1.1.243)
protein N-terminal methyltransferase (2.1.1.244)
5-methyltetrahydrosarcinapterin:corrinoid/iron-sulfur protein Co-methyltransferase (2.1.1.245)
[methyl-Co(III) methanol-specific corrinoid protein]:coenzyme M methyltransferase (2.1.1.246)
[methyl-Co(III) methylamine-specific corrinoid protein]:coenzyme M methyltransferase (2.1.1.247)
methylamine-corrinoid protein Co-methyltransferase (2.1.1.248)
dimethylamine-corrinoid protein Co-methyltransferase (2.1.1.249)
trimethylamine-corrinoid protein Co-methyltransferase (2.1.1.250)
methylated-thiol-coenzyme M methyltransferase (2.1.1.251)
tetramethylammonium-corrinoid protein Co-methyltransferase (2.1.1.252)
[methyl-Co(III) tetramethylammonium-specific corrinoid protein]:coenzyme M methyltransferase (2.1.1.253)
erythromycin 3''-O-methyltransferase (2.1.1.254)
geranyl diphosphate 2-C-methyltransferase (2.1.1.255)
tRNA (guanine6-N2)-methyltransferase (2.1.1.256)
tRNA (pseudouridine54-N1)-methyltransferase (2.1.1.257)
5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase (2.1.1.258)
[fructose-bisphosphate aldolase]-lysine N-methyltransferase (2.1.1.259)
rRNA small subunit pseudouridine methyltransferase Nep1 (2.1.1.260)
4-dimethylallyltryptophan N-methyltransferase (2.1.1.261)
squalene methyltransferase (2.1.1.262)
botryococcene C-methyltransferase (2.1.1.263)
23S rRNA (guanine2069-N7)-methyltransferase (2.1.1.264)
tellurite methyltransferase (2.1.1.265)
23S rRNA (adenine2030-N6)-methyltransferase (2.1.1.266)
flavonoid 3',5'-methyltransferase (2.1.1.267)
tRNAThr (cytosine32-N3)-methyltransferase (2.1.1.268)
dimethylsulfoniopropionate demethylase (2.1.1.269)
(+)-6a-hydroxymaackiain 3-O-methyltransferase (2.1.1.270)
cobalt-precorrin-4 methyltransferase (2.1.1.271)
cobalt-factor III methyltransferase (2.1.1.272)
benzoate O-methyltransferase (2.1.1.273)
salicylate 1-O-methyltransferase (2.1.1.274)
gibberellin A9 O-methyltransferase (2.1.1.275)
gibberellin A4 carboxyl methyltransferase (2.1.1.276)
anthranilate O-methyltransferase (2.1.1.277)
indole-3-acetate O-methyltransferase (2.1.1.278)
trans-anol O-methyltransferase (2.1.1.279)
selenocysteine Se-methyltransferase (2.1.1.280)
phenylpyruvate C3-methyltransferase (2.1.1.281)
tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase (2.1.1.282)
emodin O-methyltransferase (2.1.1.283)
8-demethylnovobiocic acid C8-methyltransferase (2.1.1.284)
demethyldecarbamoylnovobiocin O-methyltransferase (2.1.1.285)
25S rRNA (adenine2142-N1)-methyltransferase (2.1.1.286)
25S rRNA (adenine645-N1)-methyltransferase (2.1.1.287)
aklanonic acid methyltransferase (2.1.1.288)
cobalt-precorrin-7 (C5)-methyltransferase (2.1.1.289)
tRNAPhe [7-(3-amino-3-carboxypropyl)wyosine37-O]-methyltransferase (2.1.1.290)
(R,S)-reticuline 7-O-methyltransferase (2.1.1.291)
carminomycin 4-O-methyltransferase (2.1.1.292)
6-hydroxytryprostatin B O-methyltransferase (2.1.1.293)
3-O-phospho-polymannosyl GlcNAc-diphospho-ditrans,octacis-undecaprenol 3-phospho-methyltransferase (2.1.1.294)
2-methyl-6-phytyl-1,4-hydroquinone methyltransferase (2.1.1.295)
methyltransferase cap2 (2.1.1.296)
peptide chain release factor N5-glutamine methyltransferase (2.1.1.297)
ribosomal protein L3 N5-glutamine methyltransferase (2.1.1.298)
protein N-terminal monomethyltransferase (2.1.1.299)
pavine N-methyltransferase (2.1.1.300)
cypemycin N-terminal methyltransferase (2.1.1.301)
3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase (2.1.1.302)
2,7-dihydroxy-5-methyl-1-naphthoate 7-O-methyltransferase (2.1.1.303)
L-tyrosine C3-methyltransferase (2.1.1.304)
8-demethyl-8-alpha-L-rhamnosyl tetracenomycin-C 2'-O-methyltransferase (2.1.1.305)
8-demethyl-8-(2-methoxy-alpha-L-rhamnosyl)tetracenomycin-C 3'-O-methyltransferase (2.1.1.306)
8-demethyl-8-(2,3-dimethoxy-alpha-L-rhamnosyl)tetracenomycin-C 4'-O-methyltransferase (2.1.1.307)
cytidylyl-2-hydroxyethylphosphonate methyltransferase (2.1.1.308)
18S rRNA (guanine1575-N7)-methyltransferase (2.1.1.309)
25S rRNA (cytosine2870-C5)-methyltransferase (2.1.1.310)
25S rRNA (cytosine2278-C5)-methyltransferase (2.1.1.311)
25S rRNA (uracil2843-N3)-methyltransferase (2.1.1.312)
25S rRNA (uracil2634-N3)-methyltransferase (2.1.1.313)
diphthine methyl ester synthase (2.1.1.314)
27-O-demethylrifamycin SV methyltransferase (2.1.1.315)
mitomycin 6-O-methyltransferase (2.1.1.316)
sphingolipid C9-methyltransferase (2.1.1.317)
[trehalose-6-phosphate synthase]-L-cysteine S-methyltransferase (2.1.1.318)
type I protein arginine methyltransferase (2.1.1.319)
type II protein arginine methyltransferase (2.1.1.320)
type III protein arginine methyltransferase (2.1.1.321)
type IV protein arginine methyltransferase (2.1.1.322)
(-)-pluviatolide 4-O-methyltransferase (2.1.1.323)
dTDP-4-amino-2,3,4,6-tetradeoxy-D-glucose N,N-dimethyltransferase (2.1.1.324)
juvenile hormone-III synthase (2.1.1.325)
N-acetyldemethylphosphinothricin P-methyltransferase (2.1.1.326)
phenazine-1-carboxylate N-methyltransferase (2.1.1.327)
N-demethylindolmycin N-methyltransferase (2.1.1.328)
demethylphylloquinol methyltransferase (2.1.1.329)
5'-demethylyatein 5'-O-methyltransferase (2.1.1.330)
bacteriochlorophyllide d C-121-methyltransferase (2.1.1.331)
bacteriochlorophyllide d C-82-methyltransferase (2.1.1.332)
bacteriochlorophyllide d C-20 methyltransferase (2.1.1.333)
methanethiol S-methyltransferase (2.1.1.334)
4-amino-anhydrotetracycline N4-methyltransferase (2.1.1.335)
norbelladine O-methyltransferase (2.1.1.336)
reticuline N-methyltransferase (2.1.1.337)
desmethylxanthohumol 6'-O-methyltransferase (2.1.1.338)
xanthohumol 4-O-methyltransferase (2.1.1.339)
3-aminomethylindole N-methyltransferase (2.1.1.340)
vanillate/3-O-methylgallate O-demethylase (2.1.1.341)
anaerobilin synthase (2.1.1.342)
8-amino-8-demethylriboflavin N,N-dimethyltransferase (2.1.1.343)
ornithine lipid N-methyltransferase (2.1.1.344)
psilocybin synthase (2.1.1.345)
U6 snRNA m6A methyltransferase (2.1.1.346)
(+)-O-methylkolavelool synthase (2.1.1.347)
mRNA m6A methyltransferase (2.1.1.348)
toxoflavin synthase (2.1.1.349)
menaquinone C8-methyltransferase (2.1.1.350)
nocamycin O-methyltransferase (2.1.1.351)
3-O-acetyl-4'-O-demethylpapaveroxine 4'-O-methyltransferase (2.1.1.352)
demethylluteothin O-methyltransferase (2.1.1.353)
[histone H3]-lysine4 N-trimethyltransferase (2.1.1.354)
[histone H3]-lysine9 N-trimethyltransferase (2.1.1.355)
[histone H3]-lysine27 N-trimethyltransferase (2.1.1.356)
[histone H3]-lysine36 N-dimethyltransferase (2.1.1.357)
[histone H3]-dimethyl-L-lysine36 N-methyltransferase (2.1.1.358)
[histone H3]-lysine36 N-trimethyltransferase (2.1.1.359)
[histone H3]-lysine79 N-trimethyltransferase (2.1.1.360)
[histone H4]-lysine20 N-methyltransferase (2.1.1.361)
[histone H4]-N-methyl-L-lysine20 N-methyltransferase (2.1.1.362)
pre-sodorifen synthase (2.1.1.363)
[histone H3]-lysine4 N-methyltransferase (2.1.1.364)
MMP 1-O-methyltransferase (2.1.1.365)
[histone H3]-N6,N6-dimethyl-lysine9 N-methyltransferase (2.1.1.366)
[histone H3]-lysine9 N-methyltransferase (2.1.1.367)
[histone H3]-lysine9 N-dimethyltransferase (2.1.1.368)
[histone H3]-lysine27 N-methyltransferase (2.1.1.369)
[histone H3]-lysine4 N-dimethyltransferase (2.1.1.370)
[histone H3]-lysine27 N-dimethyltransferase (2.1.1.371)
[histone H4]-lysine20 N-trimethyltransferase (2.1.1.372)
2-hydroxy-4-(methylsulfanyl)butanoate S-methyltransferase (2.1.1.373)
2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase (2.1.1.374)
NNS virus cap methyltransferase (2.1.1.375)
glycine betaine-corrinoid protein Co-methyltransferase (2.1.1.376)
[methyl-Co(III) glycine betaine-specific corrinoid protein]-coenzyme M methyltransferase (2.1.1.377)
[methyl-Co(III) glycine betaine-specific corrinoid protein]-tetrahydrofolate methyltransferase (2.1.1.378)
[methyl coenzyme M reductase]-L-arginine C-5-methyltransferase (2.1.1.379)
3-amino-4-hydroxybenzoate 4-O-methyltransferase (2.1.1.380)
arginine Nomega-methyltransferase (2.1.1.381)
methoxylated aromatic compound—corrinoid protein Co-methyltransferase (2.1.1.382)
L-carnitine—corrinoid protein Co-methyltransferase (2.1.1.383)
[methyl-Co(III) methoxylated-aromatic-compound-specific corrinoid protein]—tetrahydromethanopterin methyltransferase (2.1.1.384)
[methyl-Co(III) methoxylated-aromatic-compound-specific corrinoid protein]—tetrahydrofolate methyltransferase (2.1.1.385)
glycine hydroxymethyltransferase (2.1.2.1)
cytidylate 5-hydroxymethyltransferase (2.1.2.B2)
phosphoribosylglycinamide formyltransferase 1 (2.1.2.2)
phosphoribosylaminoimidazolecarboxamide formyltransferase (2.1.2.3)
phosphoribosylglycinamide formyltransferase 2 (2.1.2.B3)
glycine formimidoyltransferase (2.1.2.4)
glutamate formimidoyltransferase (2.1.2.5)
glutamate formyltransferase (2.1.2.6)
D-alanine 2-hydroxymethyltransferase (2.1.2.7)
deoxycytidylate 5-hydroxymethyltransferase (2.1.2.8)
methionyl-tRNA formyltransferase (2.1.2.9)
aminomethyltransferase (2.1.2.10)
3-methyl-2-oxobutanoate hydroxymethyltransferase (2.1.2.11)
UDP-4-amino-4-deoxy-L-arabinose formyltransferase (2.1.2.13)
GDP-perosamine N-formyltransferase (2.1.2.14)
methylmalonyl-CoA carboxytransferase (2.1.3.1)
aspartate carbamoyltransferase (2.1.3.2)
ornithine carbamoyltransferase (2.1.3.3)
malonyl-CoA carboxyltransferase (2.1.3.4)
oxamate carbamoyltransferase (2.1.3.5)
putrescine carbamoyltransferase (2.1.3.6)
3-hydroxymethylcephem carbamoyltransferase (2.1.3.7)
lysine carbamoyltransferase (2.1.3.8)
N-acetylornithine carbamoyltransferase (2.1.3.9)
malonyl-S-ACP:biotin-protein carboxyltransferase (2.1.3.10)
N-succinylornithine carbamoyltransferase (2.1.3.11)
decarbamoylnovobiocin carbamoyltransferase (2.1.3.12)
ATP carbamoyltransferase (2.1.3.13)
tobramycin carbamoyltransferase (2.1.3.14)
acetyl-CoA carboxytransferase (2.1.3.15)
ureidoglycine carbamoyltransferase (2.1.3.16)
glycine amidinotransferase (2.1.4.1)
scyllo-inosamine-4-phosphate amidinotransferase (2.1.4.2)
L-arginine:L-lysine amidinotransferase (2.1.4.3)
sesamin methylene transferase (2.1.5.1)
transketolase (2.2.1.1)
transaldolase (2.2.1.2)
formaldehyde transketolase (2.2.1.3)
acetoin-ribose-5-phosphate transaldolase (2.2.1.4)
2-hydroxy-3-oxoadipate synthase (2.2.1.5)
acetolactate synthase (2.2.1.6)
1-deoxy-D-xylulose-5-phosphate synthase (2.2.1.7)
fluorothreonine transaldolase (2.2.1.8)
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase (2.2.1.9)
2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (2.2.1.10)
6-deoxy-5-ketofructose 1-phosphate synthase (2.2.1.11)
3-acetyloctanal synthase (2.2.1.12)
apulose-4-phosphate transketolase (2.2.1.13)
6-deoxy-6-sulfo-D-fructose transaldolase (2.2.1.14)
6-deoxy-6-sulfo-D-fructose transketolase (2.2.1.15)
amino-acid N-acetyltransferase (2.3.1.1)
imidazole N-acetyltransferase (2.3.1.2)
type I polyhydroxybutyrate synthase (2.3.1.B2)
glucosamine N-acetyltransferase (2.3.1.3)
type II polyhydroxybutyrate synthase (2.3.1.B3)
glucosamine-phosphate N-acetyltransferase (2.3.1.4)
type III polyhydroxybutyrate synthase (2.3.1.B4)
arylamine N-acetyltransferase (2.3.1.5)
unclassified polyhydroxybutyrate synthase (2.3.1.B5)
choline O-acetyltransferase (2.3.1.6)
UDP-D-GlcNAc3NA 3-N-acetyltransferase (2.3.1.B6)
carnitine O-acetyltransferase (2.3.1.7)
phosphate acetyltransferase (2.3.1.8)
acetyl-CoA C-acetyltransferase (2.3.1.9)
hydrogen-sulfide S-acetyltransferase (2.3.1.10)
thioethanolamine S-acetyltransferase (2.3.1.11)
dihydrolipoyllysine-residue acetyltransferase (2.3.1.12)
glycine N-acyltransferase (2.3.1.13)
glutamine N-phenylacetyltransferase (2.3.1.14)
glycerol-3-phosphate 1-O-acyltransferase (2.3.1.15)
acetyl-CoA C-acyltransferase (2.3.1.16)
taxoid C-13 O-phenylpropanoyltransferase (2.3.1.B16)
aspartate N-acetyltransferase (2.3.1.17)
galactoside O-acetyltransferase (2.3.1.18)
phosphate butyryltransferase (2.3.1.19)
diacylglycerol O-acyltransferase (2.3.1.20)
carnitine O-palmitoyltransferase (2.3.1.21)
2-acylglycerol O-acyltransferase (2.3.1.22)
1-acylglycerophosphocholine O-acyltransferase (2.3.1.23)
sphingosine N-acyltransferase (2.3.1.24)
octaketide synthase (2.3.1.B25)
plasmalogen synthase (2.3.1.25)
glycosyl-4,4'-diaponeurosporenoate acyltransferase (2.3.1.B26)
sterol O-acyltransferase (2.3.1.26)
cortisol O-acetyltransferase (2.3.1.27)
protein acetyltransferase (Alba1-protein acetylating) (2.3.1.B27)
chloramphenicol O-acetyltransferase (2.3.1.28)
glycine C-acetyltransferase (2.3.1.29)
serine O-acetyltransferase (2.3.1.30)
homoserine O-acetyltransferase (2.3.1.31)
lysine N-acetyltransferase (2.3.1.32)
[acyl-carrier-protein] S-methylmalonyltransferase (2.3.1.B32)
chlorogenate caffeoyltransferase (2.3.1.B33)
histidine N-acetyltransferase (2.3.1.33)
D-tryptophan N-acetyltransferase (2.3.1.34)
[protein]-L-lysine N-acetyltransferase (2.3.1.B34)
glutamate N-acetyltransferase (2.3.1.35)
D-amino-acid N-acetyltransferase (2.3.1.36)
glycerophosphocholine O-acyltransferase (2.3.1.B36)
5-aminolevulinate synthase (2.3.1.37)
phenylglycine N-acetyltransferase (2.3.1.B37)
heptylquinolone synthase (2.3.1.B38)
[acyl-carrier-protein] S-acetyltransferase (2.3.1.38)
brefelding octaketide synthase (2.3.1.B39)
[acyl-carrier-protein] S-malonyltransferase (2.3.1.39)
acyl-[acyl-carrier-protein]-phospholipid O-acyltransferase (2.3.1.40)
caliceamicin octaketide synthase (2.3.1.B40)
beta-ketoacyl-[acyl-carrier-protein] synthase I (2.3.1.41)
protein-long-chain fatty-acyl-lysine deacylase (NAD+) (2.3.1.B41)
glycerone-phosphate O-acyltransferase (2.3.1.42)
[archaeal chromatin protein Alba]-lysine deacetylase (2.3.1.B42)
phosphatidylcholine-sterol O-acyltransferase (2.3.1.43)
protein-lysine desuccinylase (NAD+) (2.3.1.B43)
actin N-acetyltransferase (2.3.1.B44)
N-acetylneuraminate 4-O-acetyltransferase (2.3.1.44)
heptaprenylglycerol processing acetyltransferase (2.3.1.B45)
N-acetylneuraminate 7-O(or 9-O)-acetyltransferase (2.3.1.45)
1-acylglycerophosphatidylinositol O-acyltransferase (2.3.1.B46)
homoserine O-succinyltransferase (2.3.1.46)
8-amino-7-oxononanoate synthase (2.3.1.47)
histone acetyltransferase (2.3.1.48)
deacetyl-[citrate-(pro-3S)-lyase] S-acetyltransferase (2.3.1.49)
serine C-palmitoyltransferase (2.3.1.50)
1-acylglycerol-3-phosphate O-acyltransferase (2.3.1.51)
2-acylglycerol-3-phosphate O-acyltransferase (2.3.1.52)
phenylalanine N-acetyltransferase (2.3.1.53)
formate C-acetyltransferase (2.3.1.54)
kanamycin 6'-N-acetyltransferase (2.3.1.55)
aromatic-hydroxylamine O-acetyltransferase (2.3.1.56)
diamine N-acetyltransferase (2.3.1.57)
2,3-diaminopropionate N-oxalyltransferase (2.3.1.58)
gentamicin 2'-N-acetyltransferase (2.3.1.59)
gentamicin 3-N-acetyltransferase (2.3.1.60)
dihydrolipoyllysine-residue succinyltransferase (2.3.1.61)
2-acylglycerophosphocholine O-acyltransferase (2.3.1.62)
1-alkylglycerophosphocholine O-acyltransferase (2.3.1.63)
agmatine N4-coumaroyltransferase (2.3.1.64)
bile acid-CoA:amino acid N-acyltransferase (2.3.1.65)
leucine N-acetyltransferase (2.3.1.66)
1-alkylglycerophosphocholine O-acetyltransferase (2.3.1.67)
glutamine N-acyltransferase (2.3.1.68)
monoterpenol O-acetyltransferase (2.3.1.69)
CDP-acylglycerol O-arachidonoyltransferase (2.3.1.70)
glycine N-benzoyltransferase (2.3.1.71)
indoleacetylglucose-inositol O-acyltransferase (2.3.1.72)
diacylglycerol-sterol O-acyltransferase (2.3.1.73)
chalcone synthase (2.3.1.74)
long-chain-alcohol O-fatty-acyltransferase (2.3.1.75)
retinol O-fatty-acyltransferase (2.3.1.76)
triacylglycerol-sterol O-acyltransferase (2.3.1.77)
heparan-alpha-glucosaminide N-acetyltransferase (2.3.1.78)
maltose O-acetyltransferase (2.3.1.79)
cysteine-S-conjugate N-acetyltransferase (2.3.1.80)
aminoglycoside 3-N-acetyltransferase (2.3.1.81)
aminoglycoside 6'-N-acetyltransferase (2.3.1.82)
phosphatidylcholine-dolichol O-acyltransferase (2.3.1.83)
alcohol O-acetyltransferase (2.3.1.84)
fatty-acid synthase system (2.3.1.85)
fatty-acyl-CoA synthase system (2.3.1.86)
aralkylamine N-acetyltransferase (2.3.1.87)
peptide alpha-N-acetyltransferase (2.3.1.88)
tetrahydrodipicolinate N-acetyltransferase (2.3.1.89)
beta-glucogallin O-galloyltransferase (2.3.1.90)
sinapoylglucose-choline O-sinapoyltransferase (2.3.1.91)
sinapoylglucose-malate O-sinapoyltransferase (2.3.1.92)
13-hydroxylupanine O-tigloyltransferase (2.3.1.93)
6-deoxyerythronolide-B synthase (2.3.1.94)
trihydroxystilbene synthase (2.3.1.95)
glycoprotein N-palmitoyltransferase (2.3.1.96)
glycylpeptide N-tetradecanoyltransferase (2.3.1.97)
chlorogenate-glucarate O-hydroxycinnamoyltransferase (2.3.1.98)
quinate O-hydroxycinnamoyltransferase (2.3.1.99)
[myelin-proteolipid] O-palmitoyltransferase (2.3.1.100)
formylmethanofuran-tetrahydromethanopterin N-formyltransferase (2.3.1.101)
N6-hydroxylysine N-acetyltransferase (2.3.1.102)
sinapoylglucose-sinapoylglucose O-sinapoyltransferase (2.3.1.103)
1-alkenylglycerophosphocholine O-acyltransferase (2.3.1.104)
alkylglycerophosphate 2-O-acetyltransferase (2.3.1.105)
tartronate O-hydroxycinnamoyltransferase (2.3.1.106)
deacetylvindoline O-acetyltransferase (2.3.1.107)
alpha-tubulin N-acetyltransferase (2.3.1.108)
arginine N-succinyltransferase (2.3.1.109)
tyramine N-feruloyltransferase (2.3.1.110)
mycocerosate synthase (2.3.1.111)
D-tryptophan N-malonyltransferase (2.3.1.112)
anthranilate N-malonyltransferase (2.3.1.113)
3,4-dichloroaniline N-malonyltransferase (2.3.1.114)
isoflavone-7-O-beta-glucoside 6''-O-malonyltransferase (2.3.1.115)
flavonol-3-O-beta-glucoside O-malonyltransferase (2.3.1.116)
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (2.3.1.117)
N-hydroxyarylamine O-acetyltransferase (2.3.1.118)
icosanoyl-CoA synthase (2.3.1.119)
6'-deoxychalcone synthase (2.3.1.120)
1-alkenylglycerophosphoethanolamine O-acyltransferase (2.3.1.121)
trehalose O-mycolyltransferase (2.3.1.122)
dolichol O-acyltransferase (2.3.1.123)
diacylglycerol acyltransferase (2.3.1.124)
1-alkyl-2-acetylglycerol O-acyltransferase (2.3.1.125)
isocitrate O-dihydroxycinnamoyltransferase (2.3.1.126)
ornithine N-benzoyltransferase (2.3.1.127)
ribosomal-protein-alanine N-acetyltransferase (2.3.1.128)
acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (2.3.1.129)
galactarate O-hydroxycinnamoyltransferase (2.3.1.130)
glucarate O-hydroxycinnamoyltransferase (2.3.1.131)
glucarolactone O-hydroxycinnamoyltransferase (2.3.1.132)
shikimate O-hydroxycinnamoyltransferase (2.3.1.133)
galactolipid O-acyltransferase (2.3.1.134)
phosphatidylcholine-retinol O-acyltransferase (2.3.1.135)
polysialic-acid O-acetyltransferase (2.3.1.136)
carnitine O-octanoyltransferase (2.3.1.137)
putrescine N-hydroxycinnamoyltransferase (2.3.1.138)
ecdysone O-acyltransferase (2.3.1.139)
rosmarinate synthase (2.3.1.140)
galactosylacylglycerol O-acyltransferase (2.3.1.141)
glycoprotein O-fatty-acyltransferase (2.3.1.142)
beta-glucogallin-tetrakisgalloylglucose O-galloyltransferase (2.3.1.143)
anthranilate N-benzoyltransferase (2.3.1.144)
piperidine N-piperoyltransferase (2.3.1.145)
pinosylvin synthase (2.3.1.146)
glycerophospholipid arachidonoyl-transferase (CoA-independent) (2.3.1.147)
glycerophospholipid acyltransferase (CoA-dependent) (2.3.1.148)
Platelet-activating factor acetyltransferase (2.3.1.149)
Salutaridinol 7-O-acetyltransferase (2.3.1.150)
2,3',4,6-tetrahydroxybenzophenone synthase (2.3.1.151)
alcohol O-cinnamoyltransferase (2.3.1.152)
anthocyanin 5-(6'''-hydroxycinnamoyltransferase) (2.3.1.153)
propionyl-CoA C2-trimethyltridecanoyltransferase (2.3.1.154)
acetyl-CoA C-myristoyltransferase (2.3.1.155)
phloroisovalerophenone synthase (2.3.1.156)
glucosamine-1-phosphate N-acetyltransferase (2.3.1.157)
phospholipid:diacylglycerol acyltransferase (2.3.1.158)
acridone synthase (2.3.1.159)
vinorine synthase (2.3.1.160)
lovastatin nonaketide synthase (2.3.1.161)
taxadien-5alpha-ol O-acetyltransferase (2.3.1.162)
10-hydroxytaxane O-acetyltransferase (2.3.1.163)
isopenicillin-N N-acyltransferase (2.3.1.164)
6-methylsalicylic-acid synthase (2.3.1.165)
2alpha-hydroxytaxane 2-O-benzoyltransferase (2.3.1.166)
10-deacetylbaccatin III 10-O-acetyltransferase (2.3.1.167)
dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (2.3.1.168)
CO-methylating acetyl-CoA synthase (2.3.1.169)
6'-deoxychalcone synthase (2.3.1.170)
anthocyanin 6''-O-malonyltransferase (2.3.1.171)
anthocyanin 5-O-glucoside 6'''-O-malonyltransferase (2.3.1.172)
flavonol-3-O-triglucoside O-coumaroyltransferase (2.3.1.173)
3-oxoadipyl-CoA thiolase (2.3.1.174)
deacetylcephalosporin-C acetyltransferase (2.3.1.175)
propanoyl-CoA C-acyltransferase (2.3.1.176)
3,5-dihydroxybiphenyl synthase (2.3.1.177)
diaminobutyrate acetyltransferase (2.3.1.178)
beta-ketoacyl-[acyl-carrier-protein] synthase II (2.3.1.179)
beta-ketoacyl-[acyl-carrier-protein] synthase III (2.3.1.180)
lipoyl(octanoyl) transferase (2.3.1.181)
(R)-citramalate synthase (2.3.1.182)
phosphinothricin acetyltransferase (2.3.1.183)
acyl-homoserine-lactone synthase (2.3.1.184)
tropine acyltransferase (2.3.1.185)
pseudotropine acyltransferase (2.3.1.186)
acetyl-S-ACP:malonate ACP transferase (2.3.1.187)
omega-hydroxypalmitate O-feruloyl transferase (2.3.1.188)
mycothiol synthase (2.3.1.189)
acetoin dehydrogenase system (2.3.1.190)
UDP-3-O-(3-hydroxyacyl)glucosamine N-acyltransferase (2.3.1.191)
glycine N-phenylacetyltransferase (2.3.1.192)
tRNAMet cytidine acetyltransferase (2.3.1.193)
acetoacetyl-CoA synthase (2.3.1.194)
(Z)-3-hexen-1-ol acetyltransferase (2.3.1.195)
benzyl alcohol O-benzoyltransferase (2.3.1.196)
dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase (2.3.1.197)
glycerol-3-phosphate 2-O-acyltransferase (2.3.1.198)
very-long-chain 3-oxoacyl-CoA synthase (2.3.1.199)
lipoyl amidotransferase (2.3.1.200)
UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase (2.3.1.201)
UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (2.3.1.202)
UDP-N-acetylbacillosamine N-acetyltransferase (2.3.1.203)
octanoyl-[GcvH]:protein N-octanoyltransferase (2.3.1.204)
fumigaclavine B O-acetyltransferase (2.3.1.205)
3,5,7-trioxododecanoyl-CoA synthase (2.3.1.206)
beta-ketodecanoyl-[acyl-carrier-protein] synthase (2.3.1.207)
4-hydroxycoumarin synthase (2.3.1.208)
dTDP-4-amino-4,6-dideoxy-D-glucose acyltransferase (2.3.1.209)
dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase (2.3.1.210)
bisdemethoxycurcumin synthase (2.3.1.211)
benzalacetone synthase (2.3.1.212)
cyanidin 3-O-(6-O-glucosyl-2-O-xylosylgalactoside) 6'''-O-hydroxycinnamoyltransferase (2.3.1.213)
pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase (2.3.1.214)
anthocyanidin 3-O-glucoside 6''-O-acyltransferase (2.3.1.215)
5,7-dihydroxy-2-methylchromone synthase (2.3.1.216)
curcumin synthase (2.3.1.217)
phenylpropanoylacetyl-CoA synthase (2.3.1.218)
demethoxycurcumin synthase (2.3.1.219)
2,4,6-trihydroxybenzophenone synthase (2.3.1.220)
noranthrone synthase (2.3.1.221)
phosphate propanoyltransferase (2.3.1.222)
3-oxo-5,6-didehydrosuberyl-CoA thiolase (2.3.1.223)
acetyl-CoA-benzylalcohol acetyltransferase (2.3.1.224)
protein S-acyltransferase (2.3.1.225)
carboxymethylproline synthase (2.3.1.226)
GDP-perosamine N-acetyltransferase (2.3.1.227)
isovaleryl-homoserine lactone synthase (2.3.1.228)
4-coumaroyl-homoserine lactone synthase (2.3.1.229)
2-heptyl-4(1H)-quinolone synthase (2.3.1.230)
tRNAPhe {7-[3-amino-3-(methoxycarbonyl)propyl]wyosine37-N}-methoxycarbonyltransferase (2.3.1.231)
methanol O-anthraniloyltransferase (2.3.1.232)
1,3,6,8-tetrahydroxynaphthalene synthase (2.3.1.233)
N6-L-threonylcarbamoyladenine synthase (2.3.1.234)
tetracenomycin F2 synthase (2.3.1.235)
5-methylnaphthoic acid synthase (2.3.1.236)
neocarzinostatin naphthoate synthase (2.3.1.237)
monacolin J acid methylbutanoate transferase (2.3.1.238)
10-deoxymethynolide synthase (2.3.1.239)
narbonolide synthase (2.3.1.240)
Kdo2-lipid IVA acyltransferase (2.3.1.241)
Kdo2-lipid IVA palmitoleoyltransferase (2.3.1.242)
acyl-Kdo2-lipid IVA acyltransferase (2.3.1.243)
2-methylbutanoate polyketide synthase (2.3.1.244)
3-hydroxy-5-phosphooxypentane-2,4-dione thiolase (2.3.1.245)
3,5-dihydroxyphenylacetyl-CoA synthase (2.3.1.246)
3-keto-5-aminohexanoate cleavage enzyme (2.3.1.247)
spermidine disinapoyl transferase (2.3.1.248)
spermidine dicoumaroyl transferase (2.3.1.249)
[Wnt protein] O-palmitoleoyl transferase (2.3.1.250)
lipid IVA palmitoyltransferase (2.3.1.251)
mycolipanoate synthase (2.3.1.252)
phloroglucinol synthase (2.3.1.253)
N-terminal methionine Nalpha-acetyltransferase NatB (2.3.1.254)
N-terminal amino-acid Nalpha-acetyltransferase NatA (2.3.1.255)
N-terminal methionine Nalpha-acetyltransferase NatC (2.3.1.256)
N-terminal L-serine Nalpha-acetyltransferase NatD (2.3.1.257)
N-terminal methionine Nalpha-acetyltransferase NatE (2.3.1.258)
N-terminal methionine Nalpha-acetyltransferase NatF (2.3.1.259)
tetracycline polyketide synthase (2.3.1.260)
(4-hydroxyphenyl)alkanoate synthase (2.3.1.261)
anthraniloyl-CoA anthraniloyltransferase (2.3.1.262)
2-amino-4-oxopentanoate thiolase (2.3.1.263)
beta-lysine N6-acetyltransferase (2.3.1.264)
phosphatidylinositol dimannoside acyltransferase (2.3.1.265)
[ribosomal protein S18]-alanine N-acetyltransferase (2.3.1.266)
[ribosomal protein S5]-alanine N-acetyltransferase (2.3.1.267)
ethanol O-acetyltransferase (2.3.1.268)
apolipoprotein N-acyltransferase (2.3.1.269)
lyso-ornithine lipid O-acyltransferase (2.3.1.270)
L-glutamate-5-semialdehyde N-acetyltransferase (2.3.1.271)
2-acetylphloroglucinol acetyltransferase (2.3.1.272)
diglucosylglycerate octanoyltransferase (2.3.1.273)
phosphate acyltransferase (2.3.1.274)
acyl phosphate:glycerol-3-phosphate acyltransferase (2.3.1.275)
galactosamine-1-phosphate N-acetyltransferase (2.3.1.276)
2-oxo-3-(phosphooxy)propyl 3-oxoalkanoate synthase (2.3.1.277)
mycolipenoyl-CoA-2-(long-chain-fatty acyl)-trehalose mycolipenoyltransferase (2.3.1.278)
long-chain-acyl-CoA-trehalose acyltransferase (2.3.1.279)
(aminoalkyl)phosphonate N-acetyltransferase (2.3.1.280)
5-hydroxydodecatetraenal polyketide synthase (2.3.1.281)
phenolphthiocerol/phthiocerol/phthiodiolone dimycocerosyl transferase (2.3.1.282)
2'-acyl-2-O-sulfo-trehalose (hydroxy)phthioceranyltransferase (2.3.1.283)
3'-(hydroxy)phthioceranyl-2'-palmitoyl(stearoyl)-2-O-sulfo-trehalose (hydroxy)phthioceranyltransferase (2.3.1.284)
(13S,14R)-1,13-dihydroxy-N-methylcanadine 13-O-acetyltransferase (2.3.1.285)
protein acetyllysine N-acetyltransferase (2.3.1.286)
phthioceranic/hydroxyphthioceranic acid synthase (2.3.1.287)
2-O-sulfo trehalose long-chain-acyltransferase (2.3.1.288)
aureothin polyketide synthase system (2.3.1.289)
spectinabilin polyketide synthase system (2.3.1.290)
sphingoid base N-palmitoyltransferase (2.3.1.291)
(phenol)carboxyphthiodiolenone synthase (2.3.1.292)
meromycolic acid 3-oxoacyl-(acyl carrier protein) synthase I (2.3.1.293)
meromycolic acid 3-oxoacyl-(acyl carrier protein) synthase II (2.3.1.294)
mycoketide-CoA synthase (2.3.1.295)
omega-hydroxyceramide transacylase (2.3.1.296)
very-long-chain ceramide synthase (2.3.1.297)
ultra-long-chain ceramide synthase (2.3.1.298)
sphingoid base N-stearoyltransferase (2.3.1.299)
branched-chain beta-ketoacyl-[acyl-carrier-protein] synthase (2.3.1.300)
mycobacterial beta-ketoacyl-[acyl carrier protein] synthase III (2.3.1.301)
hydroxycinnamoyl-CoA:5-hydroxyanthranilate N-hydroxycinnamoyltransferase (2.3.1.302)
alpha-L-Rha-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-alpha-D-Gal-PP-Und 2IV-O-acetyltransferase (2.3.1.303)
poly[(R)-3-hydroxyalkanoate] polymerase (2.3.1.304)
acyl-[acyl-carrier protein]—UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucopyranose N-acyltransferase (2.3.1.305)
acetyl-CoA:lysine N6-acetyltransferase (2.3.1.306)
6-diazo-5-oxo-L-norleucine Nalpha-acetyltranferase (2.3.1.307)
tubulin N-terminal N-acetyltransferase NAT9 (2.3.1.308)
[beta-tubulin]-L-lysine N-acetyltransferase (2.3.1.309)
benzoylsuccinyl-CoA thiolase (2.3.1.310)
D-glutamyltransferase (2.3.2.1)
lipid II:alanine alanyl transferase (2.3.2.B1)
alanyl-lipid II:alanine alanyl transferase (2.3.2.B2)
gamma-glutamyltransferase (2.3.2.2)
lysyltransferase (2.3.2.3)
phenylhydrazine ureidoglycolyl transferase (2.3.2.B3)
gamma-glutamylcyclotransferase (2.3.2.4)
glutaminyl-peptide cyclotransferase (2.3.2.5)
lysine/arginine leucyltransferase (2.3.2.6)
aspartyltransferase (2.3.2.7)
arginyltransferase (2.3.2.8)
E2:E3 ubiquitin transferase (2.3.2.B8)
agaritine gamma-glutamyltransferase (2.3.2.9)
UDP-N-acetylmuramoylpentapeptide-lysine N6-alanyltransferase (2.3.2.10)
alanylphosphatidylglycerol synthase (2.3.2.11)
ubiquitin transferase RING E3 (calmodulin-selective) (2.3.2.B11)
peptidyltransferase (2.3.2.12)
ubiquitin transferase U-box E4 (2.3.2.B12)
protein-glutamine gamma-glutamyltransferase (2.3.2.13)
ubiquitin transferase RING E3 (cullin-dependent) (2.3.2.B13)
D-alanine gamma-glutamyltransferase (2.3.2.14)
L,D-transpeptidase (2.3.2.B14)
glutathione gamma-glutamylcysteinyltransferase (2.3.2.15)
cyclo-(L-Trp-L-Trp) synthase (2.3.2.B16)
lipid II:glycine glycyltransferase (2.3.2.16)
ergosteryl-3beta-O-L-aspartate synthase (2.3.2.B17)
N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N6-glycyl)-D-alanyl-D-alanine-diphosphoundecaprenyl-N-acetylglucosamine:glycine glycyltransferase (2.3.2.17)
ergosteryl-3beta-O-glycine synthase (2.3.2.B18)
N-acetylmuramoyl-L-alanyl-D-glutamyl-L-lysyl-(N6-triglycine)-D-alanyl-D-alanine-diphosphoundecaprenyl-N-acetylglucosamine:glycine glycyltransferase (2.3.2.18)
ribostamycin:4-(gamma-L-glutamylamino)-(S)-2-hydroxybutanoyl-[BtrI acyl-carrier protein] 4-(gamma-L-glutamylamino)-(S)-2-hydroxybutanoate transferase (2.3.2.19)
cyclo(L-leucyl-L-phenylalanyl) synthase (2.3.2.20)
cyclo(L-tyrosyl-L-tyrosyl) synthase (2.3.2.21)
cyclo(L-leucyl-L-leucyl) synthase (2.3.2.22)
E2 ubiquitin-conjugating enzyme (2.3.2.23)
(E3-independent) E2 ubiquitin-conjugating enzyme (2.3.2.24)
N-terminal E2 ubiquitin-conjugating enzyme (2.3.2.25)
HECT-type E3 ubiquitin transferase (2.3.2.26)
RING-type E3 ubiquitin transferase (2.3.2.27)
L-allo-isoleucyltransferase (2.3.2.28)
aspartate/glutamate leucyltransferase (2.3.2.29)
L-ornithine Nalpha-acyltransferase (2.3.2.30)
RBR-type E3 ubiquitin transferase (2.3.2.31)
cullin-RING-type E3 NEDD8 transferase (2.3.2.32)
RCR-type E3 ubiquitin transferase (2.3.2.33)
E2 NEDD8-conjugating enzyme (2.3.2.34)
capsaicin synthase (2.3.2.35)
RING-type E3 ubiquitin transferase (cysteine targeting) (2.3.2.36)
citrate (Si)-synthase (2.3.3.1)
decylcitrate synthase (2.3.3.2)
citrate (Re)-synthase (2.3.3.3)
decylhomocitrate synthase (2.3.3.4)
2-methylcitrate synthase (2.3.3.5)
2-ethylmalate synthase (2.3.3.6)
3-ethylmalate synthase (2.3.3.7)
ATP citrate synthase (2.3.3.8)
malate synthase (2.3.3.9)
hydroxymethylglutaryl-CoA synthase (2.3.3.10)
2-hydroxyglutarate synthase (2.3.3.11)
3-propylmalate synthase (2.3.3.12)
2-isopropylmalate synthase (2.3.3.13)
homocitrate synthase (2.3.3.14)
sulfoacetaldehyde acetyltransferase (2.3.3.15)
citrate synthase (unknown stereospecificity) (2.3.3.16)
methylthioalkylmalate synthase (2.3.3.17)
2-phosphinomethylmalate synthase (2.3.3.18)
2-phosphonomethylmalate synthase (2.3.3.19)
acyl-CoA:acyl-CoA alkyltransferase (2.3.3.20)
(R)-citramalate synthase (2.3.3.21)
glycogen phosphorylase (2.4.1.1)
loliose synthase (2.4.1.B1)
dextrin dextranase (2.4.1.2)
alpha-1,4-glucan synthase (2.4.1.B3)
amylomaltase (2.4.1.3)
amylosucrase (2.4.1.4)
sterol 27-beta-glucosyltransferase (2.4.1.B4)
dextransucrase (2.4.1.5)
maltose 3-glycosyltransferase (2.4.1.6)
sucrose phosphorylase (2.4.1.7)
ursodeoxycholate N-acetylglucosaminyltransferase (2.4.1.B7)
maltose phosphorylase (2.4.1.8)
D-Glc-alpha-1-diphosphoundecaprenol 4-beta-glucosyltransferase (2.4.1.B9)
inulosucrase (2.4.1.9)
levansucrase (2.4.1.10)
glycogen(starch) synthase (2.4.1.11)
cellulose synthase (UDP-forming) (2.4.1.12)
sucrose synthase (2.4.1.13)
sucrose-phosphate synthase (2.4.1.14)
alpha,alpha-trehalose-phosphate synthase (UDP-forming) (2.4.1.15)
chitin synthase (2.4.1.16)
glucuronosyltransferase (2.4.1.17)
1,4-alpha-glucan branching enzyme (2.4.1.18)
cyclomaltodextrin glucanotransferase (2.4.1.19)
cellobiose phosphorylase (2.4.1.20)
starch synthase (glycosyl-transferring) (2.4.1.21)
lactose synthase (2.4.1.22)
sphingosine beta-galactosyltransferase (2.4.1.23)
1,4-alpha-glucan 6-alpha-glucosyltransferase (2.4.1.24)
4-alpha-glucanotransferase (2.4.1.25)
DNA alpha-glucosyltransferase (2.4.1.26)
DNA beta-glucosyltransferase (2.4.1.27)
glucosyl-DNA beta-glucosyltransferase (2.4.1.28)
cellulose synthase (GDP-forming) (2.4.1.29)
1,3-beta-oligoglucan phosphorylase (2.4.1.30)
laminaribiose phosphorylase (2.4.1.31)
glucomannan 4-beta-mannosyltransferase (2.4.1.32)
mannuronan synthase (2.4.1.33)
1,3-beta-glucan synthase (2.4.1.34)
4,6-alpha-glucanotransferase (2.4.1.B34)
phenol beta-glucosyltransferase (2.4.1.35)
alpha,alpha-trehalose-phosphate synthase (GDP-forming) (2.4.1.36)
fucosylgalactoside 3-alpha-galactosyltransferase (2.4.1.37)
beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase (2.4.1.38)
steroid N-acetylglucosaminyltransferase (2.4.1.39)
glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase (2.4.1.40)
polypeptide N-acetylgalactosaminyltransferase (2.4.1.41)
UDPglucuronate-estriol 17beta-D-glucuronosyltransferase (2.4.1.42)
polygalacturonate 4-alpha-galacturonosyltransferase (2.4.1.43)
lipopolysaccharide 3-alpha-galactosyltransferase (2.4.1.44)
2-hydroxyacylsphingosine 1-beta-galactosyltransferase (2.4.1.45)
4-O-(alpha-L-rhodosaminyl)aklavinone L-2-deoxyfucosyltransferase (2.4.1.B46)
monogalactosyldiacylglycerol synthase (2.4.1.46)
N-acylsphingosine galactosyltransferase (2.4.1.47)
heteroglycan alpha-mannosyltransferase (2.4.1.48)
cellodextrin phosphorylase (2.4.1.49)
monoglucosylarchaeol synthase (2.4.1.B50)
procollagen galactosyltransferase (2.4.1.50)
diglucosylarchaeol synthase (2.4.1.B51)
UDP-N-acetylglucosamine-glycoprotein N-acetylglucosaminyltransferase (2.4.1.51)
mixed-linkage glucan endotransglucosylase (2.4.1.B52)
poly(glycerol-phosphate) alpha-glucosyltransferase (2.4.1.52)
hesperetin 7-O-glucoside 6''-O-rhamnosyltransferase (2.4.1.B53)
poly(ribitol-phosphate) beta-glucosyltransferase (2.4.1.53)
4,4'-diaponeurosporenoate glucosyltransferase (2.4.1.B54)
undecaprenyl-phosphate mannosyltransferase (2.4.1.54)
teichoic-acid synthase (2.4.1.55)
lipopolysaccharide N-acetylglucosaminyltransferase (2.4.1.56)
phosphatidylinositol alpha-mannosyltransferase (2.4.1.57)
dolichol phosphate-mannose mannosyltransferase (2.4.1.B58)
lipopolysaccharide glucosyltransferase I (2.4.1.58)
UDPglucuronate-estradiol glucuronosyltransferase (2.4.1.59)
CDP-abequose:alpha-D-Man-(1->4)-alpha-L-Rha-(1->3)-alpha-D-Gal-PP-Und alpha-1,3-abequosyltransferase (2.4.1.60)
UDPglucuronate-estriol 16alpha-glucuronosyltransferase (2.4.1.61)
ganglioside galactosyltransferase (2.4.1.62)
small GTPase glucosyltransferase (2.4.1.B62)
linamarin synthase (2.4.1.63)
alpha,alpha-trehalose phosphorylase (2.4.1.64)
glucosyltransferase Waag (2.4.1.B64)
3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase (2.4.1.65)
4-hydroxy-3-methoxybenzyl alcohol alpha-D-glucosyltransferase (2.4.1.B65)
procollagen glucosyltransferase (2.4.1.66)
galactinol-raffinose galactosyltransferase (2.4.1.67)
glycoprotein 6-alpha-L-fucosyltransferase (2.4.1.68)
N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-glucosyltransferase (2.4.1.B69)
type 1 galactoside alpha-(1,2)-fucosyltransferase (2.4.1.69)
cyanidin 3-O-[2-O-(2-O-(sinapoyl)-beta-D-xylosyl) 6-O-(p-coumaroyl)-beta-D-glucoside] 5-O-[6-O-(malonyl)-beta-D-glucoside] 4-O-beta-D-glucosyltransferase (acyl-glucose) (2.4.1.B70)
poly(ribitol-phosphate) alpha-N-acetylglucosaminyltransferase (2.4.1.70)
arylamine glucosyltransferase (2.4.1.71)
flavonol-3-O-glucuronosyltransferase (2.4.1.B71)
1,4-beta-xylan synthase (2.4.1.72)
C-mannosyltransferase (2.4.1.B72)
lipopolysaccharide glucosyltransferase II (2.4.1.73)
GlcAGroAc2:mannosyltransferase (2.4.1.B74)
glycosaminoglycan galactosyltransferase (2.4.1.74)
UDP-galacturonosyltransferase (2.4.1.75)
2-O-alpha-D-glucosylglycerol phosphorylase (2.4.1.B76)
UDPglucuronate-bilirubin glucuronosyltransferase (2.4.1.76)
alpha-(1->2) branching sucrase (2.4.1.B77)
UDPglucuronate-bilirubin-glucuronoside glucuronosyltransferase (2.4.1.77)
flavonol-3-O-glucoside glucosyltransferase (1-6 bonding) (2.4.1.B78)
phosphopolyprenol glucosyltransferase (2.4.1.78)
globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase (2.4.1.79)
triptophenolide beta-glucosyltransferase (2.4.1.B79)
alpha-dystroglycan glucuronosyltransferase (2.4.1.B80)
ceramide glucosyltransferase (2.4.1.80)
flavone 7-O-beta-glucosyltransferase (2.4.1.81)
soyasapogenol B glucuronide arabinosyltransferase (2.4.1.B81)
galactinol-sucrose galactosyltransferase (2.4.1.82)
soyasaponin III glucosyltransferase (2.4.1.B82)
2,6,6-trimethyl-4-hydroxy-1-carboxaldehyde-1-cyclohexene glucosyltransferase (2.4.1.B83)
dolichyl-phosphate beta-D-mannosyltransferase (2.4.1.83)
apigenin 4'-O-glucosyltransferase (2.4.1.B84)
UDPglucuronate-1,2-diacylglycerol glucuronosyltransferase (2.4.1.84)
apigenin 4'-O-glucoside 7-O-glucosyltransferase (2.4.1.B85)
cyanohydrin beta-glucosyltransferase (2.4.1.85)
N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase (2.4.1.86)
N-acetyllactosaminide 3-alpha-galactosyltransferase (2.4.1.87)
globoside alpha-N-acetylgalactosaminyltransferase (2.4.1.88)
galactosylglucosaminylgalactosylglucosylceramide alpha-L-fucosyltransferase (2.4.1.89)
N-acetyllactosamine synthase (2.4.1.90)
flavonol 3-O-glucosyltransferase (2.4.1.91)
(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase (2.4.1.92)
inulin fructotransferase (depolymerizing, difructofuranose-1,2':2,3'-dianhydride-forming) (2.4.1.93)
protein N-acetylglucosaminyltransferase (2.4.1.94)
bilirubin-glucuronoside glucuronosyltransferase (2.4.1.95)
sn-glycerol-3-phosphate 1-galactosyltransferase (2.4.1.96)
1,3-beta-D-glucan phosphorylase (2.4.1.97)
UDPgalactose-N-acetylglucosamine beta-D-galactosyl-transferase (2.4.1.98)
sucrose:sucrose fructosyltransferase (2.4.1.99)
2,1-fructan:2,1-fructan 1-fructosyltransferase (2.4.1.100)
alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (2.4.1.101)
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (2.4.1.102)
alizarin 2-beta-glucosyltransferase (2.4.1.103)
o-dihydroxycoumarin 7-O-glucosyltransferase (2.4.1.104)
vitexin beta-glucosyltransferase (2.4.1.105)
isovitexin beta-glucosyltransferase (2.4.1.106)
UDPglucuronate-testosterone glucuronosyltransferase (2.4.1.107)
UDPglucuronate-phenol glucuronosyltransferase (2.4.1.108)
dolichyl-phosphate-mannose-protein mannosyltransferase (2.4.1.109)
tRNA-queuosine alpha-mannosyltransferase (2.4.1.110)
coniferyl-alcohol glucosyltransferase (2.4.1.111)
alpha-1,4-glucan-protein synthase (UDP-forming) (2.4.1.112)
alpha-1,4-glucan-protein synthase (ADP-forming) (2.4.1.113)
2-coumarate O-beta-glucosyltransferase (2.4.1.114)
anthocyanidin 3-O-glucosyltransferase (2.4.1.115)
cyanidin 3-O-rutinoside 5-O-glucosyltransferase (2.4.1.116)
dolichyl-phosphate beta-glucosyltransferase (2.4.1.117)
cytokinin 7-beta-glucosyltransferase (2.4.1.118)
dolichyl-diphosphooligosaccharideprotein glycotransferase (2.4.1.119)
sinapate 1-glucosyltransferase (2.4.1.120)
indole-3-acetate beta-glucosyltransferase (2.4.1.121)
N-acetylgalactosaminide beta-1,3-galactosyltransferase (2.4.1.122)
inositol 3-alpha-galactosyltransferase (2.4.1.123)
N-acetyllactosamine 3-alpha-galactosyltransferase (2.4.1.124)
sucrose-1,6-alpha-glucan 3(6)-alpha-glucosyltransferase (2.4.1.125)
hydroxycinnamate 4-beta-glucosyltransferase (2.4.1.126)
monoterpenol beta-glucosyltransferase (2.4.1.127)
scopoletin glucosyltransferase (2.4.1.128)
peptidoglycan glycosyltransferase (2.4.1.129)
dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase (2.4.1.130)
GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase (2.4.1.131)
GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase (2.4.1.132)
xylosylprotein 4-beta-galactosyltransferase (2.4.1.133)
galactosylxylosylprotein 3-beta-galactosyltransferase (2.4.1.134)
galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase (2.4.1.135)
gallate 1-beta-glucosyltransferase (2.4.1.136)
sn-glycerol-3-phosphate 2-alpha-galactosyltransferase (2.4.1.137)
mannotetraose 2-alpha-N-acetylglucosaminyltransferase (2.4.1.138)
maltose synthase (2.4.1.139)
alternansucrase (2.4.1.140)
N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase (2.4.1.141)
chitobiosyldiphosphodolichol beta-mannosyltransferase (2.4.1.142)
alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase (2.4.1.143)
beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase (2.4.1.144)
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase (2.4.1.145)
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase (2.4.1.146)
acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase (2.4.1.147)
acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (2.4.1.148)
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase (2.4.1.149)
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase (2.4.1.150)
N-acetyllactosaminide alpha-1,3-galactosyltransferase (2.4.1.151)
4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase (2.4.1.152)
UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminyltransferase (2.4.1.153)
globotriosylceramide beta-1,6-N-acetylgalactosaminyl-transferase (2.4.1.154)
alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase (2.4.1.155)
indolylacetyl-myo-inositol galactosyltransferase (2.4.1.156)
1,2-diacylglycerol 3-glucosyltransferase (2.4.1.157)
13-hydroxydocosanoate 13-beta-glucosyltransferase (2.4.1.158)
flavonol-3-O-glucoside L-rhamnosyltransferase (2.4.1.159)
pyridoxine 5'-O-beta-D-glucosyltransferase (2.4.1.160)
oligosaccharide 4-alpha-D-glucosyltransferase (2.4.1.161)
aldose beta-D-fructosyltransferase (2.4.1.162)
beta-galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,3-acetylglucosaminyltransferase (2.4.1.163)
galactosyl-N-acetylglucosaminylgalactosylglucosyl-ceramide beta-1,6-N-acetylglucosaminyltransferase (2.4.1.164)
N-acetylneuraminylgalactosylglucosylceramide beta-1,4-N-acetylgalactosaminyltransferase (2.4.1.165)
raffinose-raffinose alpha-galactosyltransferase (2.4.1.166)
sucrose 6F-alpha-galactosyltransferase (2.4.1.167)
xyloglucan 4-glucosyltransferase (2.4.1.168)
xyloglucan 6-xylosyltransferase (2.4.1.169)
isoflavone 7-O-glucosyltransferase (2.4.1.170)
methyl-ONN-azoxymethanol beta-D-glucosyltransferase (2.4.1.171)
salicyl-alcohol beta-D-glucosyltransferase (2.4.1.172)
sterol 3beta-glucosyltransferase (2.4.1.173)
glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase (2.4.1.174)
glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase (2.4.1.175)
gibberellin beta-D-glucosyltransferase (2.4.1.176)
cinnamate beta-D-glucosyltransferase (2.4.1.177)
hydroxymandelonitrile glucosyltransferase (2.4.1.178)
lactosylceramide beta-1,3-galactosyltransferase (2.4.1.179)
lipopolysaccharide N-acetylmannosaminouronosyltransferase (2.4.1.180)
hydroxyanthraquinone glucosyltransferase (2.4.1.181)
lipid-A-disaccharide synthase (2.4.1.182)
alpha-1,3-glucan synthase (2.4.1.183)
galactolipid galactosyltransferase (2.4.1.184)
flavanone 7-O-beta-glucosyltransferase (2.4.1.185)
glycogenin glucosyltransferase (2.4.1.186)
N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase (2.4.1.187)
N-acetylglucosaminyldiphosphoundecaprenol glucosyltransferase (2.4.1.188)
luteolin 7-O-glucuronosyltransferase (2.4.1.189)
luteolin-7-O-glucuronide 2''-O-glucuronosyltransferase (2.4.1.190)
luteolin-7-O-diglucuronide 4'-O-glucuronosyltransferase (2.4.1.191)
nuatigenin 3beta-glucosyltransferase (2.4.1.192)
sarsapogenin 3beta-glucosyltransferase (2.4.1.193)
4-hydroxybenzoate 4-O-beta-D-glucosyltransferase (2.4.1.194)
N-hydroxythioamide S-beta-glucosyltransferase (2.4.1.195)
nicotinate glucosyltransferase (2.4.1.196)
high-mannose-oligosaccharide beta-1,4-N-acetylglucosaminyltransferase (2.4.1.197)
phosphatidylinositol N-acetylglucosaminyltransferase (2.4.1.198)
beta-mannosylphosphodecaprenol-mannooligosaccharide 6-mannosyltransferase (2.4.1.199)
inulin fructotransferase (depolymerizing, difructofuranose-1,2':2',1-dianhydride-forming) (2.4.1.200)
alpha-1,6-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase (2.4.1.201)
2,4-dihydroxy-7-methoxy-2H-1,4-benzoxazin-3(4H)-one 2-D-glucosyltransferase (2.4.1.202)
trans-zeatin O-beta-D-glucosyltransferase (2.4.1.203)
zeatin O-beta-D-xylosyltransferase (2.4.1.204)
galactogen 6beta-galactosyltransferase (2.4.1.205)
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase (2.4.1.206)
xyloglucan:xyloglucosyl transferase (2.4.1.207)
diglucosyl diacylglycerol synthase (1,2-linking) (2.4.1.208)
cis-p-coumarate glucosyltransferase (2.4.1.209)
limonoid glucosyltransferase (2.4.1.210)
1,3-beta-galactosyl-N-acetylhexosamine phosphorylase (2.4.1.211)
hyaluronan synthase (2.4.1.212)
glucosylglycerol-phosphate synthase (2.4.1.213)
glycoprotein 3-alpha-L-fucosyltransferase (2.4.1.214)
cis-zeatin O-beta-D-glucosyltransferase (2.4.1.215)
trehalose 6-phosphate phosphorylase (2.4.1.216)
mannosyl-3-phosphoglycerate synthase (2.4.1.217)
hydroquinone glucosyltransferase (2.4.1.218)
vomilenine glucosyltransferase (2.4.1.219)
indoxyl-UDPG glucosyltransferase (2.4.1.220)
peptide-O-fucosyltransferase (2.4.1.221)
O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase (2.4.1.222)
glucuronosyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase (2.4.1.223)
glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase (2.4.1.224)
N-acetylglucosaminyl-proteoglycan 4-beta-glucuronosyltransferase (2.4.1.225)
N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase (2.4.1.226)
undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase (2.4.1.227)
lactosylceramide 4-alpha-galactosyltransferase (2.4.1.228)
[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase (2.4.1.229)
kojibiose phosphorylase (2.4.1.230)
alpha,alpha-trehalose phosphorylase (configuration-retaining) (2.4.1.231)
initiation-specific alpha-1,6-mannosyltransferase (2.4.1.232)
anthocyanidin 3-O-glucosyltransferase (2.4.1.233)
kaempferol 3-O-galactosyltransferase (2.4.1.234)
cyanidin 3-O-rutinoside 5-O-glucosyltransferase (2.4.1.235)
flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase (2.4.1.236)
flavonol 7-O-beta-glucosyltransferase (2.4.1.237)
delphinidin 3,5-di-O-glucoside 3'-O-glucosyltransferase (2.4.1.238)
flavonol-3-O-glucoside glucosyltransferase (2.4.1.239)
flavonol-3-O-glycoside glucosyltransferase (2.4.1.240)
digalactosyldiacylglycerol synthase (2.4.1.241)
NDP-glucose-starch glucosyltransferase (2.4.1.242)
6G-fructosyltransferase (2.4.1.243)
N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase (2.4.1.244)
alpha,alpha-trehalose synthase (2.4.1.245)
mannosylfructose-phosphate synthase (2.4.1.246)
beta-D-galactosyl-(1->4)-L-rhamnose phosphorylase (2.4.1.247)
cycloisomaltooligosaccharide glucanotransferase (2.4.1.248)
delphinidin 3',5'-O-glucosyltransferase (2.4.1.249)
D-inositol-3-phosphate glycosyltransferase (2.4.1.250)
GlcA-beta-(1->2)-D-Man-alpha-(1->3)-D-Glc-beta-(1->4)-D-Glc-alpha-1-diphospho-ditrans,octacis-undecaprenol 4-beta-mannosyltransferase (2.4.1.251)
GDP-mannose:cellobiosyl-diphosphopolyprenol alpha-mannosyltransferase (2.4.1.252)
baicalein 7-O-glucuronosyltransferase (2.4.1.253)
cyanidin-3-O-glucoside 2''-O-glucuronosyltransferase (2.4.1.254)
protein O-GlcNAc transferase (2.4.1.255)
dolichyl-P-Glc:Glc2Man9GlcNAc2-PP-dolichol alpha-1,2-glucosyltransferase (2.4.1.256)
GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase (2.4.1.257)
dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase (2.4.1.258)
dolichyl-P-Man:Man6GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase (2.4.1.259)
dolichyl-P-Man:Man7GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase (2.4.1.260)
dolichyl-P-Man:Man8GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase (2.4.1.261)
soyasapogenol glucuronosyltransferase (2.4.1.262)
abscisate beta-glucosyltransferase (2.4.1.263)
D-Man-alpha-(1->3)-D-Glc-beta-(1->4)-D-Glc-alpha-1-diphosphoundecaprenol 2-beta-glucuronosyltransferase (2.4.1.264)
dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichol alpha-1,3-glucosyltransferase (2.4.1.265)
glucosyl-3-phosphoglycerate synthase (2.4.1.266)
dolichyl-P-Glc:Man9GlcNAc2-PP-dolichol alpha-1,3-glucosyltransferase (2.4.1.267)
glucosylglycerate synthase (2.4.1.268)
mannosylglycerate synthase (2.4.1.269)
mannosylglucosyl-3-phosphoglycerate synthase (2.4.1.270)
crocetin glucosyltransferase (2.4.1.271)
soyasapogenol B glucuronide galactosyltransferase (2.4.1.272)
soyasaponin III rhamnosyltransferase (2.4.1.273)
glucosylceramide beta-1,4-galactosyltransferase (2.4.1.274)
neolactotriaosylceramide beta-1,4-galactosyltransferase (2.4.1.275)
zeaxanthin glucosyltransferase (2.4.1.276)
10-deoxymethynolide desosaminyltransferase (2.4.1.277)
3-alpha-mycarosylerythronolide B desosaminyl transferase (2.4.1.278)
nigerose phosphorylase (2.4.1.279)
N,N'-diacetylchitobiose phosphorylase (2.4.1.280)
4-O-beta-D-mannosyl-D-glucose phosphorylase (2.4.1.281)
3-O-alpha-D-glucosyl-L-rhamnose phosphorylase (2.4.1.282)
2-deoxystreptamine N-acetyl-D-glucosaminyltransferase (2.4.1.283)
2-deoxystreptamine glucosyltransferase (2.4.1.284)
UDP-GlcNAc:ribostamycin N-acetylglucosaminyltransferase (2.4.1.285)
chalcone 4'-O-glucosyltransferase (2.4.1.286)
rhamnopyranosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,4/1,5-galactofuranosyltransferase (2.4.1.287)
galactofuranosylgalactofuranosylrhamnosyl-N-acetylglucosaminyl-diphospho-decaprenol beta-1,5/1,6-galactofuranosyltransferase (2.4.1.288)
N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase (2.4.1.289)
N,N'-diacetylbacillosaminyl-diphospho-undecaprenol alpha-1,3-N-acetylgalactosaminyltransferase (2.4.1.290)
N-acetylgalactosamine-N,N'-diacetylbacillosaminyl-diphospho-undecaprenol 4-alpha-N-acetylgalactosaminyltransferase (2.4.1.291)
GalNAc-alpha-(1->4)-GalNAc-alpha-(1->3)-diNAcBac-PP-undecaprenol alpha-1,4-N-acetyl-D-galactosaminyltransferase (2.4.1.292)
GalNAc5-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase (2.4.1.293)
cyanidin 3-O-galactosyltransferase (2.4.1.294)
anthocyanin 3-O-sambubioside 5-O-glucosyltransferase (2.4.1.295)
anthocyanidin 3-O-coumaroylrutinoside 5-O-glucosyltransferase (2.4.1.296)
anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase (2.4.1.297)
anthocyanidin 3-O-glucoside 5-O-glucosyltransferase (2.4.1.298)
cyanidin 3-O-glucoside 5-O-glucosyltransferase (acyl-glucose) (2.4.1.299)
cyanidin 3-O-glucoside 7-O-glucosyltransferase (acyl-glucose) (2.4.1.300)
2'-deamino-2'-hydroxyneamine 1-alpha-D-kanosaminyltransferase (2.4.1.301)
L-demethylnoviosyl transferase (2.4.1.302)
UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase (2.4.1.303)
UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,4-galactosyltransferase (2.4.1.304)
UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase (2.4.1.305)
UDP-GalNAc:alpha-D-GalNAc-diphosphoundecaprenol alpha-1,3-N-acetylgalactosaminyltransferase (2.4.1.306)
UDP-Gal:alpha-D-GalNAc-1,3-alpha-D-GalNAc-diphosphoundecaprenol beta-1,3-galactosyltransferase (2.4.1.307)
GDP-Fuc:beta-D-Gal-1,3-alpha-D-GalNAc-1,3-alpha-GalNAc-diphosphoundecaprenol alpha-1,2-fucosyltransferase (2.4.1.308)
UDP-Gal:alpha-L-Fuc-1,2-beta-Gal-1,3-alpha-GalNAc-1,3-alpha-GalNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase (2.4.1.309)
vancomycin aglycone glucosyltransferase (2.4.1.310)
chloroorienticin B synthase (2.4.1.311)
protein O-mannose beta-1,4-N-acetylglucosaminyltransferase (2.4.1.312)
protein O-mannose beta-1,3-N-acetylgalactosaminyltransferase (2.4.1.313)
ginsenoside Rd glucosyltransferase (2.4.1.314)
diglucosyl diacylglycerol synthase (1,6-linking) (2.4.1.315)
tylactone mycaminosyltransferase (2.4.1.316)
O-mycaminosyltylonolide 6-deoxyallosyltransferase (2.4.1.317)
demethyllactenocin mycarosyltransferase (2.4.1.318)
beta-1,4-mannooligosaccharide phosphorylase (2.4.1.319)
1,4-beta-mannosyl-N-acetylglucosamine phosphorylase (2.4.1.320)
cellobionic acid phosphorylase (2.4.1.321)
devancosaminyl-vancomycin vancosaminetransferase (2.4.1.322)
7-deoxyloganetic acid glucosyltransferase (2.4.1.323)
7-deoxyloganetin glucosyltransferase (2.4.1.324)
TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (2.4.1.325)
aklavinone 7-L-rhodosaminyltransferase (2.4.1.326)
aclacinomycin-T 2-deoxy-L-fucose transferase (2.4.1.327)
erythronolide mycarosyltransferase (2.4.1.328)
sucrose 6F-phosphate phosphorylase (2.4.1.329)
beta-D-glucosyl crocetin beta-1,6-glucosyltransferase (2.4.1.330)
8-demethyltetracenomycin C L-rhamnosyltransferase (2.4.1.331)
1,2-alpha-glucosylglycerol phosphorylase (2.4.1.332)
1,2-beta-oligoglucan phosphorylase (2.4.1.333)
1,3-alpha-oligoglucan phosphorylase (2.4.1.334)
dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase (2.4.1.335)
monoglucosyldiacylglycerol synthase (2.4.1.336)
1,2-diacylglycerol 3-alpha-glucosyltransferase (2.4.1.337)
validoxylamine A glucosyltransferase (2.4.1.338)
beta-1,2-mannobiose phosphorylase (2.4.1.339)
1,2-beta-oligomannan phosphorylase (2.4.1.340)
alpha-1,2-colitosyltransferase (2.4.1.341)
alpha-maltose-1-phosphate synthase (2.4.1.342)
UDP-Gal:alpha-D-GlcNAc-diphosphoundecaprenol alpha-1,3-galactosyltransferase (2.4.1.343)
type 2 galactoside alpha-(1,2)-fucosyltransferase (2.4.1.344)
phosphatidyl-myo-inositol alpha-mannosyltransferase (2.4.1.345)
phosphatidyl-myo-inositol dimannoside synthase (2.4.1.346)
alpha,alpha-trehalose-phosphate synthase (ADP-forming) (2.4.1.347)
N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 3-alpha-mannosyltransferase (2.4.1.348)
mannosyl-N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 3-alpha-mannosyltransferase (2.4.1.349)
mogroside IE synthase (2.4.1.350)
rhamnogalacturonan I rhamnosyltransferase (2.4.1.351)
glucosylglycerate phosphorylase (2.4.1.352)
sordaricin 6-deoxyaltrosyltransferase (2.4.1.353)
(R)-mandelonitrile beta-glucosyltransferase (2.4.1.354)
poly(ribitol-phosphate) beta-N-acetylglucosaminyltransferase (2.4.1.355)
glucosyl-dolichyl phosphate glucuronosyltransferase (2.4.1.356)
phlorizin synthase (2.4.1.357)
acylphloroglucinol glucosyltransferase (2.4.1.358)
glucosylglycerol phosphorylase (configuration-retaining) (2.4.1.359)
2-hydroxyflavanone C-glucosyltransferase (2.4.1.360)
GDP-mannose:di-myo-inositol-1,3'-phosphate beta-1,2-mannosyltransferase (2.4.1.361)
alpha-(1->3) branching sucrase (2.4.1.362)
ginsenoside 20-O-glucosyltransferase (2.4.1.363)
protopanaxadiol-type ginsenoside 3-O-glucosyltransferase (2.4.1.364)
protopanaxadiol-type ginsenoside-3-O-glucoside 2''-O-glucosyltransferase (2.4.1.365)
ginsenoside F1 6-O-glucosyltransferase (2.4.1.366)
ginsenoside 6-O-glucosyltransferase (2.4.1.367)
oleanolate 3-O-glucosyltransferase (2.4.1.368)
enterobactin C-glucosyltransferase (2.4.1.369)
inositol phosphorylceramide mannosyltransferase (2.4.1.370)
polymannosyl GlcNAc-diphospho-ditrans,octacis-undecaprenol 2,3-alpha-mannosylpolymerase (2.4.1.371)
mutansucrase (2.4.1.372)
alpha-(1->2) branching sucrase (2.4.1.373)
beta-1,2-mannooligosaccharide synthase (2.4.1.374)
rhamnogalacturonan I galactosyltransferase (2.4.1.375)
EGF-domain serine glucosyltransferase (2.4.1.376)
dTDP-Rha:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-rhamnosyltransferase (2.4.1.377)
GDP-mannose:alpha-L-Rha-(1->3)-alpha-D-Gal-PP-Und alpha-1,4-mannosyltransferase (2.4.1.378)
GDP-Man:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-mannosyltransferase (2.4.1.379)
GDP-Man:alpha-D-Man-(1->3)-alpha-D-Gal diphosphoundecaprenol alpha-1,2-mannosyltransferase (2.4.1.380)
dTDP-Rha:alpha-D-Man-(1->3)-alpha-D-Gal diphosphoundecaprenol alpha-1,2-rahmnosyltransferase (2.4.1.381)
CDP-abequose:alpha-L-Rha2OAc-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-alpha-D-Gal-PP-Und alpha-1,3-abequosyltransferase (2.4.1.382)
GDP-Man:alpha-L-Rha-(1->3)-alpha-D-Gal-PP-Und beta-1,4-mannosyltransferase (2.4.1.383)
NDP-glycosyltransferase (2.4.1.384)
sterol 27-beta-glucosyltransferase (2.4.1.385)
GlcNAc-beta-1,3-Gal beta-1,6-N-acetylglucosaminyltransferase (distally acting) (2.4.1.386)
isomaltosyltransferase (2.4.1.387)
glucosylgalactose phosphorylase (2.4.1.388)
solabiose phosphorylase (2.4.1.389)
purine-nucleoside phosphorylase (2.4.2.1)
pyrimidine-nucleoside phosphorylase (2.4.2.2)
uridine phosphorylase (2.4.2.3)
(KDO)2-lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase (2.4.2.B4)
thymidine phosphorylase (2.4.2.4)
nucleoside ribosyltransferase (2.4.2.5)
nucleoside deoxyribosyltransferase (2.4.2.6)
adenine phosphoribosyltransferase (2.4.2.7)
nicotinate mononucleotide:base phosphoribosyltransferase (2.4.2.B7)
hypoxanthine phosphoribosyltransferase (2.4.2.8)
uracil phosphoribosyltransferase (2.4.2.9)
orotate phosphoribosyltransferase (2.4.2.10)
nicotinate phosphoribosyltransferase (2.4.2.11)
NAD+-protein-arginine ADP-ribosyltransferase (2.4.2.B12)
nicotinamide phosphoribosyltransferase (2.4.2.12)
NAD+-protein-arginine ADP-ribosyltransferase (2.4.2.B13)
Recommended Name never specified (2.4.2.13)
amidophosphoribosyltransferase (2.4.2.14)
guanosine phosphorylase (2.4.2.15)
urate-ribonucleoside phosphorylase (2.4.2.16)
ATP phosphoribosyltransferase (2.4.2.17)
alpha-dystroglycan xylosyltransferase (2.4.2.B18)
anthranilate phosphoribosyltransferase (2.4.2.18)
nicotinate-nucleotide diphosphorylase (carboxylating) (2.4.2.19)
dioxotetrahydropyrimidine phosphoribosyltransferase (2.4.2.20)
nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (2.4.2.21)
xanthine phosphoribosyltransferase (2.4.2.22)
deoxyuridine phosphorylase (2.4.2.23)
1,4-beta-D-xylan synthase (2.4.2.24)
flavone apiosyltransferase (2.4.2.25)
protein xylosyltransferase (2.4.2.26)
dTDP-dihydrostreptose-streptidine-6-phosphate dihydrostreptosyltransferase (2.4.2.27)
S-methyl-5'-thioadenosine phosphorylase (2.4.2.28)
tRNA-guanosine34 preQ1 transglycosylase (2.4.2.29)
NAD+ ADP-ribosyltransferase (2.4.2.30)
NAD+-protein-arginine ADP-ribosyltransferase (2.4.2.31)
dolichyl-phosphate D-xylosyltransferase (2.4.2.32)
dolichyl-xylosyl-phosphate-protein xylosyltransferase (2.4.2.33)
indolylacetylinositol arabinosyltransferase (2.4.2.34)
flavonol-3-O-glycoside xylosyltransferase (2.4.2.35)
NAD+-diphthamide ADP-ribosyltransferase (2.4.2.36)
NAD+-dinitrogen-reductase ADP-D-ribosyltransferase (2.4.2.37)
glycoprotein 2-beta-D-xylosyltransferase (2.4.2.38)
xyloglucan 6-xylosyltransferase (2.4.2.39)
zeatin O-beta-D-xylosyltransferase (2.4.2.40)
xylogalacturonan beta-1,3-xylosyltransferase (2.4.2.41)
UDP-D-xylose:beta-D-glucoside alpha-1,3-D-xylosyltransferase (2.4.2.42)
lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase (2.4.2.43)
S-methyl-5'-thioinosine phosphorylase (2.4.2.44)
decaprenyl-phosphate phosphoribosyltransferase (2.4.2.45)
galactan 5-O-arabinofuranosyltransferase (2.4.2.46)
arabinofuranan 3-O-arabinosyltransferase (2.4.2.47)
tRNA-guanine15 transglycosylase (2.4.2.48)
neamine phosphoribosyltransferase (2.4.2.49)
cyanidin 3-O-galactoside 2''-O-xylosyltransferase (2.4.2.50)
anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase (2.4.2.51)
triphosphoribosyl-dephospho-CoA synthase (2.4.2.52)
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (2.4.2.53)
beta-ribofuranosylphenol 5'-phosphate synthase (2.4.2.54)
nicotinate D-ribonucleotide:phenol phospho-D-ribosyltransferase (2.4.2.55)
kaempferol 3-O-xylosyltransferase (2.4.2.56)
AMP phosphorylase (2.4.2.57)
hydroxyproline O-arabinosyltransferase (2.4.2.58)
sulfide-dependent adenosine diphosphate thiazole synthase (2.4.2.59)
cysteine-dependent adenosine diphosphate thiazole synthase (2.4.2.60)
alpha-dystroglycan beta1,4-xylosyltransferase (2.4.2.61)
xylosyl alpha-1,3-xylosyltransferase (2.4.2.62)
EGF-domain serine xylosyltransferase (2.4.2.63)
tRNA-guanosine34 queuine transglycosylase (2.4.2.64)
beta-galactoside alpha-(2,6)-sialyltransferase (2.4.3.1)
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3-sialyltransferase (2.4.3.2)
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (2.4.3.3)
beta-galactoside alpha-2,3-sialyltransferase (2.4.3.4)
galactosyldiacylglycerol alpha-2,3-sialyltransferase (2.4.3.5)
N-acetyllactosaminide alpha-2,3-sialyltransferase (2.4.3.6)
alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3-N-acetylgalactosaminide 6-alpha-sialyltransferase (2.4.3.7)
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase (2.4.3.8)
lactosylceramide alpha-2,3-sialyltransferase (2.4.3.9)
N-acetylglucosaminide alpha-(2,6)-sialyltransferase (2.4.3.10)
beta-galactoside alpha-(2,6)-sialyltransferase (2.4.99.1)
beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminide alpha-2,3-sialyltransferase (2.4.99.2)
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase (2.4.99.3)
beta-galactoside alpha-2,3-sialyltransferase (2.4.99.4)
acarviosyl transferase (2.4.99.B5)
galactosyldiacylglycerol alpha-2,3-sialyltransferase (2.4.99.5)
lipopolysaccharide heptosyltransferase I (2.4.99.B6)
N-acetyllactosaminide alpha-2,3-sialyltransferase (2.4.99.6)
alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3-N-acetylgalactosaminide 6-alpha-sialyltransferase (2.4.99.7)
lipopolysaccharide heptosyltransferase II (2.4.99.B7)
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase (2.4.99.8)
lactosylceramide alpha-2,3-sialyltransferase (2.4.99.9)
lipopolysaccharide heptosyltransferase III (2.4.99.B9)
neolactotetraosylceramide alpha-2,3-sialyltransferase (2.4.99.10)
lactosylceramide alpha-2,6-N-sialyltransferase (2.4.99.11)
lipid IVA 3-deoxy-D-manno-octulosonic acid transferase (2.4.99.12)
(Kdo)-lipid IVA 3-deoxy-D-manno-octulosonic acid transferase (2.4.99.13)
(KDO)2-lipid IVA (2-8) 3-deoxy-D-manno-octulosonic acid transferase (2.4.99.14)
(KDO)3-lipid IVA (2-4) 3-deoxy-D-manno-octulosonic acid transferase (2.4.99.15)
starch synthase (maltosyl-transferring) (2.4.99.16)
S-adenosylmethionine:tRNA ribosyltransferase-isomerase (2.4.99.17)
dolichyl-diphosphooligosaccharide-protein glycotransferase (2.4.99.18)
undecaprenyl-diphosphooligosaccharide-protein glycotransferase (2.4.99.19)
2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase (2.4.99.20)
dolichyl-phosphooligosaccharide-protein glycotransferase (2.4.99.21)
N-acetylglucosaminide alpha-(2,6)-sialyltransferase (2.4.99.22)
lipopolysaccharide heptosyltransferase I (2.4.99.23)
lipopolysaccharide heptosyltransferase II (2.4.99.24)
lipopolysaccharide heptosyltransferase III (2.4.99.25)
dimethylallyltranstransferase (2.5.1.1)
farnesylgeranyltransferase (2.5.1.B1)
thiamine pyridinylase (2.5.1.2)
thiamine phosphate synthase (2.5.1.3)
adenosylmethionine cyclotransferase (2.5.1.4)
galactose-6-sulfurylase (2.5.1.5)
lumazine synthase (2.5.1.B6)
methionine adenosyltransferase (2.5.1.6)
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (2.5.1.7)
tRNA isopentenyltransferase (2.5.1.8)
riboflavin synthase (2.5.1.9)
trans-heptaprenyltranstransferase (2.5.1.B9)
(2E,6E)-farnesyl diphosphate synthase (2.5.1.10)
trans-octaprenyltranstransferase (2.5.1.11)
glutathione S-alkyltransferase (2.5.1.12)
glutathione S-aryltransferase (2.5.1.13)
(2E,6E)-farnesyl-diphosphate all-trans-nonaprenyl diphosphate synthase (2.5.1.B14)
glutathione S-aralkyltransferase (2.5.1.14)
dihydropteroate synthase (2.5.1.15)
spermidine synthase (2.5.1.16)
corrinoid adenosyltransferase (2.5.1.17)
glutathione transferase (2.5.1.18)
3-phosphoshikimate 1-carboxyvinyltransferase (2.5.1.19)
rubber cis-polyprenylcistransferase (2.5.1.20)
S-adenosyl-L-methionine hydroxide adenosyltransferase (2.5.1.B21)
squalene synthase (2.5.1.21)
spermine synthase (2.5.1.22)
sym-norspermidine synthase (2.5.1.23)
discadenine synthase (2.5.1.24)
2,7-dihydroxynaphthalene 3-dimethylallyltransferase (2.5.1.B25)
tRNA-uridine aminocarboxypropyltransferase (2.5.1.25)
alkylglycerone-phosphate synthase (2.5.1.26)
adenylate dimethylallyltransferase (2.5.1.27)
dimethylallylcistransferase (2.5.1.28)
geranylgeranyl diphosphate synthase (2.5.1.29)
heptaprenyl diphosphate synthase (2.5.1.30)
5-dimethylallyltryptophan synthase (2.5.1.B31)
ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (2.5.1.31)
15-cis-phytoene synthase (2.5.1.32)
trans-pentaprenyltranstransferase (2.5.1.33)
4-dimethylallyltryptophan synthase (2.5.1.34)
aspulvinone dimethylallyltransferase (2.5.1.35)
tetratrans,hexacis-undecaprenyl-diphosphate synthase [geranylfarnesyl-diphosphate specific] (2.5.1.B35)
trihydroxypterocarpan dimethylallyltransferase (2.5.1.36)
leukotriene-C4 synthase (2.5.1.37)
isonocardicin synthase (2.5.1.38)
4-hydroxybenzoate polyprenyltransferase (2.5.1.39)
aristolochene synthase (2.5.1.40)
phosphoglycerol geranylgeranyltransferase (2.5.1.41)
trifunctional (all-E)-isoprenyl diphospate synthase (2.5.1.B41)
geranylgeranylglycerol-phosphate geranylgeranyltransferase (2.5.1.42)
bacteriochlorophyll a synthase (phytyl-transferring) (2.5.1.B43)
nicotianamine synthase (2.5.1.43)
homospermidine synthase (2.5.1.44)
N-1-dimethylallyltryptophan synthase (2.5.1.B44)
8-prenyltransferase (2.5.1.B45)
homospermidine synthase (spermidine-specific) (2.5.1.45)
deoxyhypusine synthase (2.5.1.46)
pt2 prenyltransferase (2.5.1.B46)
cysteine synthase (2.5.1.47)
L-histidine 2-aminobutanoyltransferase (2.5.1.B47)
cystathionine gamma-synthase (2.5.1.48)
O-acetylhomoserine aminocarboxypropyltransferase (2.5.1.49)
zeatin 9-aminocarboxyethyltransferase (2.5.1.50)
beta-pyrazolylalanine synthase (2.5.1.51)
L-mimosine synthase (2.5.1.52)
uracilylalanine synthase (2.5.1.53)
3-deoxy-7-phosphoheptulonate synthase (2.5.1.54)
3-deoxy-8-phosphooctulonate synthase (2.5.1.55)
N-acetylneuraminate synthase (2.5.1.56)
N-acylneuraminate-9-phosphate synthase (2.5.1.57)
protein farnesyltransferase (2.5.1.58)
protein geranylgeranyltransferase type I (2.5.1.59)
protein geranylgeranyltransferase type II (2.5.1.60)
hydroxymethylbilane synthase (2.5.1.61)
chlorophyll synthase (2.5.1.62)
adenosyl-fluoride synthase (2.5.1.63)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (2.5.1.64)
O-phosphoserine sulfhydrylase (2.5.1.65)
N2-(2-carboxyethyl)arginine synthase (2.5.1.66)
chrysanthemyl diphosphate synthase (2.5.1.67)
(2Z,6E)-farnesyl diphosphate synthase (2.5.1.68)
lavandulyl diphosphate synthase (2.5.1.69)
naringenin 8-dimethylallyltransferase (2.5.1.70)
leachianone-G 2''-dimethylallyltransferase (2.5.1.71)
quinolinate synthase (2.5.1.72)
O-phospho-L-seryl-tRNA:Cys-tRNA synthase (2.5.1.73)
1,4-dihydroxy-2-naphthoate polyprenyltransferase (2.5.1.74)
tRNA dimethylallyltransferase (2.5.1.75)
cysteate synthase (2.5.1.76)
7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase (2.5.1.77)
6,7-dimethyl-8-ribityllumazine synthase (2.5.1.78)
thermospermine synthase (2.5.1.79)
7-dimethylallyltryptophan synthase (2.5.1.80)
geranylfarnesyl diphosphate synthase (2.5.1.81)
hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific] (2.5.1.82)
hexaprenyl diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific] (2.5.1.83)
all-trans-nonaprenyl diphosphate synthase [geranyl-diphosphate specific] (2.5.1.84)
all-trans-nonaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific] (2.5.1.85)
trans,polycis-decaprenyl diphosphate synthase (2.5.1.86)
ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific] (2.5.1.87)
trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific] (2.5.1.88)
tritrans,polycis-undecaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific] (2.5.1.89)
all-trans-octaprenyl-diphosphate synthase (2.5.1.90)
all-trans-decaprenyl-diphosphate synthase (2.5.1.91)
(2Z,6Z)-farnesyl diphosphate synthase (2.5.1.92)
4-hydroxybenzoate geranyltransferase (2.5.1.93)
adenosyl-chloride synthase (2.5.1.94)
xanthan ketal pyruvate transferase (2.5.1.95)
4,4'-diapophytoene synthase (2.5.1.96)
pseudaminic acid synthase (2.5.1.97)
Rhizobium leguminosarum exopolysaccharide glucosyl ketal-pyruvate-transferase (2.5.1.98)
all-trans-phytoene synthase (2.5.1.99)
fumigaclavine A dimethylallyltransferase (2.5.1.100)
N,N'-diacetyllegionaminate synthase (2.5.1.101)
geranyl-pyrophosphate-olivetolic acid geranyltransferase (2.5.1.102)
presqualene diphosphate synthase (2.5.1.103)
N1-aminopropylagmatine synthase (2.5.1.104)
7,8-dihydropterin-6-yl-methyl-4-(beta-D-ribofuranosyl)aminobenzene 5'-phosphate synthase (2.5.1.105)
tryprostatin B synthase (2.5.1.106)
verruculogen prenyltransferase (2.5.1.107)
2-(3-amino-3-carboxypropyl)histidine synthase (2.5.1.108)
brevianamide F prenyltransferase (deoxybrevianamide E-forming) (2.5.1.109)
12alpha,13alpha-dihydroxyfumitremorgin C prenyltransferase (2.5.1.110)
4-hydroxyphenylpyruvate 3-dimethylallyltransferase (2.5.1.111)
adenylate dimethylallyltransferase (ADP/ATP-dependent) (2.5.1.112)
[CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase (2.5.1.113)
tRNAPhe (4-demethylwyosine37-C7) aminocarboxypropyltransferase (2.5.1.114)
homogentisate phytyltransferase (2.5.1.115)
homogentisate geranylgeranyltransferase (2.5.1.116)
homogentisate solanesyltransferase (2.5.1.117)
beta-(isoxazolin-5-on-2-yl)-L-alanine synthase (2.5.1.118)
beta-(isoxazolin-5-on-4-yl)-L-alanine synthase (2.5.1.119)
aminodeoxyfutalosine synthase (2.5.1.120)
5,10-dihydrophenazine-1-carboxylate 9-dimethylallyltransferase (2.5.1.121)
4-O-dimethylallyl-L-tyrosine synthase (2.5.1.122)
flaviolin linalyltransferase (2.5.1.123)
6-linalyl-2-O,3-dimethylflaviolin synthase (2.5.1.124)
7-geranyloxy-5-hydroxy-2-methoxy-3-methylnaphthalene-1,4-dione synthase (2.5.1.125)
norspermine synthase (2.5.1.126)
caldopentamine synthase (2.5.1.127)
N4-bis(aminopropyl)spermidine synthase (2.5.1.128)
flavin prenyltransferase (2.5.1.129)
2-carboxy-1,4-naphthoquinone phytyltransferase (2.5.1.130)
(4-{4-[2-(gamma-L-glutamylamino)ethyl]phenoxymethyl}furan-2-yl)methanamine synthase (2.5.1.131)
3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphate synthase (2.5.1.132)
bacteriochlorophyll a synthase (2.5.1.133)
cystathionine beta-synthase (O-acetyl-L-serine) (2.5.1.134)
validamine 7-phosphate valienyltransferase (2.5.1.135)
2-acylphloroglucinol 4-prenyltransferase (2.5.1.136)
2-acyl-4-prenylphloroglucinol 6-prenyltransferase (2.5.1.137)
coumarin 8-geranyltransferase (2.5.1.138)
umbelliferone 6-dimethylallyltransferase (2.5.1.139)
N-(2-amino-2-carboxyethyl)-L-glutamate synthase (2.5.1.140)
heme o synthase (2.5.1.141)
nerylneryl diphosphate synthase (2.5.1.142)
pyridinium-3,5-biscarboxylic acid mononucleotide synthase (2.5.1.143)
S-sulfo-L-cysteine synthase (O-acetyl-L-serine-dependent) (2.5.1.144)
phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (2.5.1.145)
3-geranyl-3-[(Z)-2-isocyanoethenyl]indole synthase (2.5.1.146)
5-amino-6-(D-ribitylamino)uracil-L-tyrosine 4-hydroxyphenyl transferase (2.5.1.147)
lycopaoctaene synthase (2.5.1.148)
lycopene elongase/hydratase (flavuxanthin-forming) (2.5.1.149)
lycopene elongase/hydratase (dihydrobisanhydrobacterioruberin-forming) (2.5.1.150)
alkylcobalamin dealkylase (2.5.1.151)
D-histidine 2-aminobutanoyltransferase (2.5.1.152)
adenosine tuberculosinyltransferase (2.5.1.153)
corrinoid adenosyltransferase EutT (2.5.1.154)
phosphoglycerol geranylfarnesyltransferase (2.5.1.155)
geranylfarnesylglycerol-phosphate geranylfarnesyltransferase (2.5.1.156)
aspartate transaminase (2.6.1.1)
alanine transaminase (2.6.1.2)
aminopentol:pyruvate aminotransferase FumI (2.6.1.B3)
cysteine transaminase (2.6.1.3)
glycine transaminase (2.6.1.4)
tyrosine transaminase (2.6.1.5)
dTDP-4-amino-4,6-dideoxy-alpha-D-glucopyranose transaminase (2.6.1.B6)
leucine transaminase (2.6.1.6)
kynurenine-oxoglutarate transaminase (2.6.1.7)
2,5-diaminovalerate transaminase (2.6.1.8)
histidinol-phosphate transaminase (2.6.1.9)
D-aspartate transaminase (2.6.1.10)
acetylornithine transaminase (2.6.1.11)
alanine-oxo-acid transaminase (2.6.1.12)
ornithine aminotransferase (2.6.1.13)
asparagine-oxo-acid transaminase (2.6.1.14)
glutamine-pyruvate transaminase (2.6.1.15)
amine transaminase (2.6.1.B16)
glutamine-fructose-6-phosphate transaminase (isomerizing) (2.6.1.16)
4-hydroxyphenylglycine transaminase (2.6.1.B17)
succinyldiaminopimelate transaminase (2.6.1.17)
archeosine synthase (ammonia) (2.6.1.B18)
beta-alanine-pyruvate transaminase (2.6.1.18)
4-aminobutyrate-2-oxoglutarate transaminase (2.6.1.19)
dTDP-3-amino-3,6-dideoxy-D-glucose transaminase (2.6.1.B19)
7-cyano-7-deazaguanine-containing tRNA lyase (2.6.1.B20)
tyrosine-pyruvate transaminase (2.6.1.20)
(R)-amine:2-oxo acid transaminase (2.6.1.B21)
D-amino-acid transaminase (2.6.1.21)
(S)-3-amino-2-methylpropionate transaminase (2.6.1.22)
omega-diamine transaminase (2.6.1.B22)
2-aminobutyrate-2-oxoglutarate transaminase (2.6.1.B23)
4-hydroxyglutamate transaminase (2.6.1.23)
diiodotyrosine transaminase (2.6.1.24)
thyroxine transaminase (2.6.1.25)
thyroid-hormone transaminase (2.6.1.26)
tryptophan transaminase (2.6.1.27)
tryptophan-phenylpyruvate transaminase (2.6.1.28)
diamine transaminase (2.6.1.29)
pyridoxamine-pyruvate transaminase (2.6.1.30)
pyridoxamine-oxaloacetate transaminase (2.6.1.31)
valine-3-methyl-2-oxovalerate transaminase (2.6.1.32)
dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (2.6.1.33)
UDP-N-acetylbacillosamine transaminase (2.6.1.34)
glycine-oxaloacetate transaminase (2.6.1.35)
L-lysine 6-transaminase (2.6.1.36)
2-aminoethylphosphonate-pyruvate transaminase (2.6.1.37)
histidine transaminase (2.6.1.38)
2-aminoadipate transaminase (2.6.1.39)
(R)-3-amino-2-methylpropionate-pyruvate transaminase (2.6.1.40)
D-methionine-pyruvate transaminase (2.6.1.41)
branched-chain-amino-acid transaminase (2.6.1.42)
aminolevulinate transaminase (2.6.1.43)
alanine-glyoxylate transaminase (2.6.1.44)
serine-glyoxylate transaminase (2.6.1.45)
diaminobutyrate-pyruvate transaminase (2.6.1.46)
alanine-oxomalonate transaminase (2.6.1.47)
5-aminovalerate transaminase (2.6.1.48)
dihydroxyphenylalanine transaminase (2.6.1.49)
glutamine-scyllo-inositol transaminase (2.6.1.50)
serine-pyruvate transaminase (2.6.1.51)
phosphoserine transaminase (2.6.1.52)
glutamate synthase (2.6.1.53)
pyridoxamine-phosphate transaminase (2.6.1.54)
taurine-2-oxoglutarate transaminase (2.6.1.55)
1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase (2.6.1.56)
aromatic-amino-acid transaminase (2.6.1.57)
phenylalanine(histidine) transaminase (2.6.1.58)
dTDP-4-amino-4,6-dideoxygalactose transaminase (2.6.1.59)
aromatic-amino-acid-glyoxylate transaminase (2.6.1.60)
(R)-3-amino-2-methylpropionate transaminase (2.6.1.61)
adenosylmethionine-8-amino-7-oxononanoate transaminase (2.6.1.62)
kynurenine-glyoxylate transaminase (2.6.1.63)
glutamine-phenylpyruvate transaminase (2.6.1.64)
N6-acetyl-beta-lysine transaminase (2.6.1.65)
valine-pyruvate transaminase (2.6.1.66)
2-aminohexanoate transaminase (2.6.1.67)
ornithine(lysine) transaminase (2.6.1.68)
N2-acetylornithine 5-transaminase (2.6.1.69)
aspartate-phenylpyruvate transaminase (2.6.1.70)
lysine-pyruvate 6-transaminase (2.6.1.71)
D-4-hydroxyphenylglycine transaminase (2.6.1.72)
methionine-glyoxylate transaminase (2.6.1.73)
cephalosporin-C transaminase (2.6.1.74)
cysteine-conjugate transaminase (2.6.1.75)
diaminobutyrate-2-oxoglutarate transaminase (2.6.1.76)
taurine-pyruvate aminotransferase (2.6.1.77)
aspartate-prephenate aminotransferase (2.6.1.78)
glutamate-prephenate aminotransferase (2.6.1.79)
nicotianamine aminotransferase (2.6.1.80)
succinylornithine transaminase (2.6.1.81)
putrescine-2-oxoglutarate transaminase (2.6.1.82)
LL-diaminopimelate aminotransferase (2.6.1.83)
arginine-pyruvate transaminase (2.6.1.84)
aminodeoxychorismate synthase (2.6.1.85)
2-amino-4-deoxychorismate synthase (2.6.1.86)
UDP-4-amino-4-deoxy-L-arabinose aminotransferase (2.6.1.87)
methionine transaminase (2.6.1.88)
dTDP-3-amino-3,6-dideoxy-alpha-D-glucopyranose transaminase (2.6.1.89)
dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (2.6.1.90)
UDP-4-amino-4,6-dideoxy-N-acetyl-alpha-D-glucosamine transaminase (2.6.1.91)
UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (2.6.1.92)
neamine transaminase (2.6.1.93)
2'-deamino-2'-hydroxyneamine transaminase (2.6.1.94)
neomycin C transaminase (2.6.1.95)
4-aminobutyrate-pyruvate transaminase (2.6.1.96)
archaeosine synthase (2.6.1.97)
UDP-2-acetamido-2-deoxy-ribo-hexuluronate aminotransferase (2.6.1.98)
L-tryptophan-pyruvate aminotransferase (2.6.1.99)
L-glutamine:2-deoxy-scyllo-inosose aminotransferase (2.6.1.100)
L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase (2.6.1.101)
GDP-perosamine synthase (2.6.1.102)
(S)-3,5-dihydroxyphenylglycine transaminase (2.6.1.103)
3-dehydro-glucose-6-phosphate-glutamate transaminase (2.6.1.104)
lysine-8-amino-7-oxononanoate transaminase (2.6.1.105)
dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (2.6.1.106)
beta-methylphenylalanine transaminase (2.6.1.107)
(5-formylfuran-3-yl)methyl phosphate transaminase (2.6.1.108)
8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase (2.6.1.109)
dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase (2.6.1.110)
3-aminobutanoyl-CoA transaminase (2.6.1.111)
(S)-ureidoglycine-glyoxylate transaminase (2.6.1.112)
putrescine-pyruvate transaminase (2.6.1.113)
8-demethyl-8-aminoriboflavin-5'-phosphate synthase (2.6.1.114)
5-hydroxydodecatetraenal 1-aminotransferase (2.6.1.115)
6-aminohexanoate aminotransferase (2.6.1.116)
L-glutamine-4-(methylsulfanyl)-2-oxobutanoate aminotransferase (2.6.1.117)
[amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (2.6.1.118)
vanillin aminotransferase (2.6.1.119)
beta-alanine—2-oxoglutarate transaminase (2.6.1.120)
8-amino-7-oxononanoate carboxylating dehydrogenase (2.6.1.121)
UDP-N-acetyl-3-dehydro-alpha-D-glucosamine 3-aminotranferase (2.6.1.122)
4-amino-4-deoxychorismate synthase (2-amino-4-deoxychorismate-forming) (2.6.1.123)
[amino-group carrier protein]-gamma-(L-ornithyl)-L-glutamate aminotransferase (2.6.1.124)
Recommended Name never specified (2.6.2.1)
oximinotransferase (2.6.3.1)
dATP(dGTP)-DNA purinetransferase (2.6.99.1)
pyridoxine 5'-phosphate synthase (2.6.99.2)
O-ureido-L-serine synthase (2.6.99.3)
N6-L-threonylcarbamoyladenine synthase (2.6.99.4)
hexokinase (2.7.1.1)
glucokinase (2.7.1.2)
ketohexokinase (2.7.1.3)
fructokinase (2.7.1.4)
rhamnulokinase (2.7.1.5)
D-tagatose-1-phosphate kinase (2.7.1.B6)
galactokinase (2.7.1.6)
mannokinase (2.7.1.7)
glucosamine kinase (2.7.1.8)
acetylaminodeoxyglucose kinase (2.7.1.9)
phosphoglucokinase (2.7.1.10)
6-phosphofructokinase (2.7.1.11)
gluconokinase (2.7.1.12)
dehydrogluconokinase (2.7.1.13)
sedoheptulokinase (2.7.1.14)
ribokinase (2.7.1.15)
ribulokinase (2.7.1.16)
xylulokinase (2.7.1.17)
phosphoribokinase (2.7.1.18)
geranylgeraniol kinase (2.7.1.B19)
phosphoribulokinase (2.7.1.19)
adenosine kinase (2.7.1.20)
broad specificity nucleoside kinase (2.7.1.B20)
thymidine kinase (2.7.1.21)
ribosylnicotinamide kinase (2.7.1.22)
lipopolysaccharide core heptose(I) kinase (2.7.1.B23)
NAD+ kinase (2.7.1.23)
dephospho-CoA kinase (2.7.1.24)
adenylyl-sulfate kinase (2.7.1.25)
aminoglycoside 3'-phosphotransferase (2.7.1.B26)
riboflavin kinase (2.7.1.26)
D-tagatose-1-phosphate kinase (2.7.1.B27)
erythritol kinase (D-erythritol 4-phosphate-forming) (2.7.1.27)
levoglucosan kinase (2.7.1.B28)
triokinase (2.7.1.28)
5-phosphomevalonate 3-kinase (2.7.1.B29)
glycerone kinase (2.7.1.29)
dephospho-CoA kinase (GTP-dependent) (2.7.1.B30)
glycerol kinase (2.7.1.30)
glycerate 3-kinase (2.7.1.31)
choline kinase (2.7.1.32)
pantothenate kinase (2.7.1.33)
pantetheine kinase (2.7.1.34)
pyridoxal kinase (2.7.1.35)
mevalonate kinase (2.7.1.36)
protein kinase (2.7.1.37)
phosphorylase kinase (2.7.1.38)
homoserine kinase (2.7.1.39)
pyruvate kinase (2.7.1.40)
glucose-1-phosphate phosphodismutase (2.7.1.41)
riboflavin phosphotransferase (2.7.1.42)
glucuronokinase (2.7.1.43)
galacturonokinase (2.7.1.44)
2-dehydro-3-deoxygluconokinase (2.7.1.45)
L-arabinokinase (2.7.1.46)
D-ribulokinase (2.7.1.47)
uridine/cytidine kinase (2.7.1.48)
hydroxymethylpyrimidine kinase (2.7.1.49)
hydroxyethylthiazole kinase (2.7.1.50)
L-fuculokinase (2.7.1.51)
fucokinase (2.7.1.52)
L-xylulokinase (2.7.1.53)
D-arabinokinase (2.7.1.54)
allose kinase (2.7.1.55)
1-phosphofructokinase (2.7.1.56)
mannitol kinase (2.7.1.57)
2-dehydro-3-deoxygalactonokinase (2.7.1.58)
N-acetylglucosamine kinase (2.7.1.59)
N-acylmannosamine kinase (2.7.1.60)
acyl-phosphate-hexose phosphotransferase (2.7.1.61)
phosphoramidate-hexose phosphotransferase (2.7.1.62)
polyphosphate-glucose phosphotransferase (2.7.1.63)
inositol 3-kinase (2.7.1.64)
scyllo-inosamine 4-kinase (2.7.1.65)
undecaprenol kinase (2.7.1.66)
1-phosphatidylinositol 4-kinase (2.7.1.67)
1-phosphatidylinositol-4-phosphate 5-kinase (2.7.1.68)
protein-Npi-phosphohistidine-sugar phosphotransferase (2.7.1.69)
protamine kinase (2.7.1.70)
shikimate kinase (2.7.1.71)
streptomycin 6-kinase (2.7.1.72)
inosine kinase (2.7.1.73)
deoxycytidine kinase (2.7.1.74)
thymidine kinase (2.7.1.75)
2'-deoxyadenosine kinase (2.7.1.76)
nucleoside phosphotransferase (2.7.1.77)
polynucleotide 5'-hydroxyl-kinase (2.7.1.78)
diphosphate-glycerol phosphotransferase (2.7.1.79)
diphosphate-serine phosphotransferase (2.7.1.80)
hydroxylysine kinase (2.7.1.81)
ethanolamine kinase (2.7.1.82)
pseudouridine kinase (2.7.1.83)
alkylglycerone kinase (2.7.1.84)
beta-glucoside kinase (2.7.1.85)
NADH kinase (2.7.1.86)
streptomycin 3''-kinase (2.7.1.87)
dihydrostreptomycin-6-phosphate 3'alpha-kinase (2.7.1.88)
thiamine kinase (2.7.1.89)
diphosphate-fructose-6-phosphate 1-phosphotransferase (2.7.1.90)
sphingosine kinase (2.7.1.91)
5-dehydro-2-deoxygluconokinase (2.7.1.92)
alkylglycerol kinase (2.7.1.93)
acylglycerol kinase (2.7.1.94)
kanamycin kinase (2.7.1.95)
NADH kinase (2.7.1.96)
opsin kinase (2.7.1.97)
phosphoenolpyruvate-fructose phosphotransferase (2.7.1.98)
[pyruvate dehydrogenase (lipoamide)] kinase (2.7.1.99)
S-methyl-5-thioribose kinase (2.7.1.100)
tagatose kinase (2.7.1.101)
hamamelose kinase (2.7.1.102)
viomycin kinase (2.7.1.103)
diphosphate-protein phosphotransferase (2.7.1.104)
6-phosphofructo-2-kinase (2.7.1.105)
glucose-1,6-bisphosphate synthase (2.7.1.106)
diacylglycerol kinase (ATP) (2.7.1.107)
dolichol kinase (2.7.1.108)
[hydroxymethylglutaryl-CoA reductase (NADPH)] kinase (2.7.1.109)
dephospho-[reductase kinase] kinase (2.7.1.110)
[Acetyl-CoA carboxylase] kinase (2.7.1.111)
protein-tyrosine kinase (2.7.1.112)
deoxyguanosine kinase (2.7.1.113)
AMP-thymidine kinase (2.7.1.114)
[3-methyl-2-oxobutanoate dehydrogenase (lipoamide)] kinase (2.7.1.115)
[isocitrate dehydrogenase (NADP+)] kinase (2.7.1.116)
myosin-light-chain kinase (2.7.1.117)
ADP-thymidine kinase (2.7.1.118)
hygromycin-B 7''-O-kinase (2.7.1.119)
caldesmon kinase (2.7.1.120)
phosphoenolpyruvate-glycerone phosphotransferase (2.7.1.121)
xylitol kinase (2.7.1.122)
Ca2+/calmodulin-dependent protein kinase (2.7.1.123)
[tyrosine 3-monooxygenase] kinase (2.7.1.124)
rhodopsin kinase (2.7.1.125)
beta-adrenergic-receptor kinase (2.7.1.126)
inositol-trisphosphate 3-kinase (2.7.1.127)
[acetyl-CoA carboxylase] kinase (2.7.1.128)
myosin-heavy-chain kinase (2.7.1.129)
tetraacyldisaccharide 4'-kinase (2.7.1.130)
low-density-lipoprotein kinase (2.7.1.131)
tropomyosin kinase (2.7.1.132)
inositol-trisphosphate 6-kinase (2.7.1.133)
inositol-tetrakisphosphate 1-kinase (2.7.1.134)
tau-protein kinase (2.7.1.135)
macrolide 2'-kinase (2.7.1.136)
phosphatidylinositol 3-kinase (2.7.1.137)
ceramide kinase (2.7.1.138)
inositol-trisphosphate 5-kinase (2.7.1.139)
inositol-tetrakisphosphate 5-kinase (2.7.1.140)
[RNA-polymerase]-subunit kinase (2.7.1.141)
glycerol-3-phosphate-glucose phosphotransferase (2.7.1.142)
diphosphate-purine nucleoside kinase (2.7.1.143)
tagatose-6-phosphate kinase (2.7.1.144)
deoxynucleoside kinase (2.7.1.145)
ADP-specific phosphofructokinase (2.7.1.146)
ADP-specific glucose/glucosamine kinase (2.7.1.147)
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (2.7.1.148)
1-phosphatidylinositol-5-phosphate 4-kinase (2.7.1.149)
1-phosphatidylinositol-3-phosphate 5-kinase (2.7.1.150)
inositol-polyphosphate multikinase (2.7.1.151)
inositol-hexakisphosphate kinase (2.7.1.152)
phosphatidylinositol-4,5-bisphosphate 3-kinase (2.7.1.153)
phosphatidylinositol-4-phosphate 3-kinase (2.7.1.154)
diphosphoinositol-pentakisphosphate kinase (2.7.1.155)
adenosylcobinamide kinase (2.7.1.156)
N-acetylgalactosamine kinase (2.7.1.157)
inositol-pentakisphosphate 2-kinase (2.7.1.158)
inositol-1,3,4-trisphosphate 5/6-kinase (2.7.1.159)
2'-phosphotransferase (2.7.1.160)
CTP-dependent riboflavin kinase (2.7.1.161)
N-acetylhexosamine 1-kinase (2.7.1.162)
hygromycin B 4-O-kinase (2.7.1.163)
O-phosphoseryl-tRNASec kinase (2.7.1.164)
glycerate 2-kinase (2.7.1.165)
3-deoxy-D-manno-octulosonic acid kinase (2.7.1.166)
D-glycero-beta-D-manno-heptose-7-phosphate kinase (2.7.1.167)
D-glycero-alpha-D-manno-heptose-7-phosphate kinase (2.7.1.168)
pantoate kinase (2.7.1.169)
anhydro-N-acetylmuramic acid kinase (2.7.1.170)
protein-fructosamine 3-kinase (2.7.1.171)
protein-ribulosamine 3-kinase (2.7.1.172)
nicotinate riboside kinase (2.7.1.173)
diacylglycerol kinase (CTP) (2.7.1.174)
maltokinase (2.7.1.175)
UDP-N-acetylglucosamine kinase (2.7.1.176)
L-threonine kinase (2.7.1.177)
2-dehydro-3-deoxyglucono/galactono-kinase (2.7.1.178)
kanosamine kinase (2.7.1.179)
FAD:protein FMN transferase (2.7.1.180)
polymannosyl GlcNAc-diphospho-ditrans,octacis-undecaprenol kinase (2.7.1.181)
phytol kinase (2.7.1.182)
glycoprotein-mannosyl O6-kinase (2.7.1.183)
sulfofructose kinase (2.7.1.184)
mevalonate 3-kinase (2.7.1.185)
mevalonate-3-phosphate 5-kinase (2.7.1.186)
acarbose 7IV-phosphotransferase (2.7.1.187)
2-epi-5-epi-valiolone 7-kinase (2.7.1.188)
autoinducer-2 kinase (2.7.1.189)
aminoglycoside 2''-phosphotransferase (2.7.1.190)
protein-Npi-phosphohistidine-D-mannose phosphotransferase (2.7.1.191)
protein-Npi-phosphohistidine-N-acetylmuramate phosphotransferase (2.7.1.192)
protein-Npi-phosphohistidine-N-acetyl-D-glucosamine phosphotransferase (2.7.1.193)
protein-Npi-phosphohistidine-L-ascorbate phosphotransferase (2.7.1.194)
protein-Npi-phosphohistidine-2-O-alpha-mannosyl-D-glycerate phosphotransferase (2.7.1.195)
protein-Npi-phosphohistidine-N,N'-diacetylchitobiose phosphotransferase (2.7.1.196)
protein-Npi-phosphohistidine-D-mannitol phosphotransferase (2.7.1.197)
protein-Npi-phosphohistidine-D-sorbitol phosphotransferase (2.7.1.198)
protein-Npi-phosphohistidine-D-glucose phosphotransferase (2.7.1.199)
protein-Npi-phosphohistidine-galactitol phosphotransferase (2.7.1.200)
protein-Npi-phosphohistidine-trehalose phosphotransferase (2.7.1.201)
protein-Npi-phosphohistidine-D-fructose phosphotransferase (2.7.1.202)
protein-Npi-phosphohistidine-D-glucosaminate phosphotransferase (2.7.1.203)
protein-Npi-phosphohistidine-D-galactose phosphotransferase (2.7.1.204)
protein-Npi-phosphohistidine-cellobiose phosphotransferase (2.7.1.205)
protein-Npi-phosphohistidine-L-sorbose phosphotransferase (2.7.1.206)
protein-Npi-phosphohistidine-lactose phosphotransferase (2.7.1.207)
protein-Npi-phosphohistidine-maltose phosphotransferase (2.7.1.208)
L-erythrulose 1-kinase (2.7.1.209)
D-erythrulose 4-kinase (2.7.1.210)
protein-Npi-phosphohistidine-sucrose phosphotransferase (2.7.1.211)
alpha-D-ribose-1-phosphate 5-kinase (ADP) (2.7.1.212)
cytidine kinase (2.7.1.213)
C7-cyclitol 7-kinase (2.7.1.214)
erythritol kinase (D-erythritol 1-phosphate-forming) (2.7.1.215)
farnesol kinase (2.7.1.216)
3-dehydrotetronate 4-kinase (2.7.1.217)
fructoselysine 6-kinase (2.7.1.218)
D-threonate 4-kinase (2.7.1.219)
D-erythronate 4-kinase (2.7.1.220)
N-acetylmuramate 1-kinase (2.7.1.221)
4-hydroxytryptamine kinase (2.7.1.222)
aminoimidazole riboside kinase (2.7.1.223)
cytidine diphosphoramidate kinase (2.7.1.224)
L-serine kinase (ATP) (2.7.1.225)
L-serine kinase (ADP) (2.7.1.226)
inositol phosphorylceramide synthase (2.7.1.227)
mannosyl-inositol-phosphoceramide inositolphosphotransferase (2.7.1.228)
deoxyribokinase (2.7.1.229)
amicoumacin kinase (2.7.1.230)
3-oxoisoapionate kinase (2.7.1.231)
levoglucosan kinase (2.7.1.232)
apulose kinase (2.7.1.233)
D-tagatose-1-phosphate kinase (2.7.1.234)
lipopolysaccharide core heptose(I) kinase (2.7.1.235)
NAD+ 3'-kinase (2.7.1.236)
GTP-dependent dephospho-CoA kinase (2.7.1.237)
phenol phosphorylase (2.7.1.238)
acetate kinase (2.7.2.1)
carbamate kinase (2.7.2.2)
phosphoglycerate kinase (2.7.2.3)
aspartate kinase (2.7.2.4)
carbamoyl-phosphate synthase (ammonia) (2.7.2.5)
formate kinase (2.7.2.6)
butyrate kinase (2.7.2.7)
acetylglutamate kinase (2.7.2.8)
carbamoyl-phosphate synthase (glutamine) (2.7.2.9)
phosphoglycerate kinase (GTP) (2.7.2.10)
glutamate 5-kinase (2.7.2.11)
acetate kinase (diphosphate) (2.7.2.12)
glutamate 1-kinase (2.7.2.13)
branched-chain-fatty-acid kinase (2.7.2.14)
propionate kinase (2.7.2.15)
2-phosphoglycerate kinase (2.7.2.16)
[amino group carrier protein]-L-2-aminoadipate 6-kinase (2.7.2.17)
fatty acid kinase (2.7.2.18)
[amino-group carrier protein]-L-glutamate 6-kinase (2.7.2.19)
guanidinoacetate kinase (2.7.3.1)
creatine kinase (2.7.3.2)
arginine kinase (2.7.3.3)
taurocyamine kinase (2.7.3.4)
lombricine kinase (2.7.3.5)
hypotaurocyamine kinase (2.7.3.6)
opheline kinase (2.7.3.7)
ammonia kinase (2.7.3.8)
phosphoenolpyruvate-protein phosphotransferase (2.7.3.9)
agmatine kinase (2.7.3.10)
protein-histidine pros-kinase (2.7.3.11)
protein-histidine tele-kinase (2.7.3.12)
glutamine kinase (2.7.3.13)
ATP-polyphosphate phosphotransferase (2.7.4.1)
yeast UMP kinase (2.7.4.B1)
phosphomevalonate kinase (2.7.4.2)
adenylate kinase (2.7.4.3)
geranylgeranyl phosphate kinase (2.7.4.B4)
nucleoside-phosphate kinase (2.7.4.4)
deoxycytidylate kinase (2.7.4.5)
nucleoside-diphosphate kinase (2.7.4.6)
phosphooxymethylpyrimidine kinase (2.7.4.7)
polyphosphate kinase (NTP) (2.7.4.B7)
guanylate kinase (2.7.4.8)
dTMP kinase (2.7.4.9)
nucleoside-triphosphate-adenylate kinase (2.7.4.10)
(deoxy)adenylate kinase (2.7.4.11)
T2-induced deoxynucleotide kinase (2.7.4.12)
(deoxy)nucleoside-phosphate kinase (2.7.4.13)
UMP/CMP kinase (2.7.4.14)
thiamine-diphosphate kinase (2.7.4.15)
thiamine-phosphate kinase (2.7.4.16)
3-phosphoglyceroyl-phosphate-polyphosphate phosphotransferase (2.7.4.17)
farnesyl-diphosphate kinase (2.7.4.18)
5-methyldeoxycytidine-5'-phosphate kinase (2.7.4.19)
dolichyl-diphosphate-polyphosphate phosphotransferase (2.7.4.20)
inositol-hexakisphosphate 5-kinase (2.7.4.21)
UMP kinase (2.7.4.22)
ribose 1,5-bisphosphate phosphokinase (2.7.4.23)
diphosphoinositol-pentakisphosphate 1-kinase (2.7.4.24)
(d)CMP kinase (2.7.4.25)
isopentenyl phosphate kinase (2.7.4.26)
[pyruvate, phosphate dikinase]-phosphate phosphotransferase (2.7.4.27)
[pyruvate, water dikinase]-phosphate phosphotransferase (2.7.4.28)
Kdo2-lipid A phosphotransferase (2.7.4.29)
lipid A phosphoethanolamine transferase (2.7.4.30)
[5-(aminomethyl)furan-3-yl]methyl phosphate kinase (2.7.4.31)
farnesyl phosphate kinase (2.7.4.32)
AMP-polyphosphate phosphotransferase (2.7.4.33)
GDP-polyphosphate phosphotransferase (2.7.4.34)
phosphoglucomutase (2.7.5.1)
acetylglucosamine phosphomutase (2.7.5.2)
phosphoglyceromutase (2.7.5.3)
bisphosphoglyceromutase (2.7.5.4)
phosphoglucomutase (glucose-cofactor) (2.7.5.5)
phosphopentomutase (2.7.5.6)
phosphomannomutase (2.7.5.7)
ribose-phosphate diphosphokinase (2.7.6.1)
thiamine diphosphokinase (2.7.6.2)
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (2.7.6.3)
nucleotide diphosphokinase (2.7.6.4)
GTP diphosphokinase (2.7.6.5)
nicotinamide-nucleotide adenylyltransferase (2.7.7.1)
FAD synthase (2.7.7.2)
pantetheine-phosphate adenylyltransferase (2.7.7.3)
thiamine diphosphate adenylyltransferase (2.7.7.B3)
adenylyltransferase UBA4 (2.7.7.B4)
sulfate adenylyltransferase (2.7.7.4)
adenylyltransferase ThiI (2.7.7.B5)
sulfate adenylyltransferase (ADP) (2.7.7.5)
DNA-directed RNA polymerase (2.7.7.6)
DNA-directed DNA polymerase (2.7.7.7)
polyribonucleotide nucleotidyltransferase (2.7.7.8)
UTP-glucose-1-phosphate uridylyltransferase (2.7.7.9)
UTP-hexose-1-phosphate uridylyltransferase (2.7.7.10)
UTP-xylose-1-phosphate uridylyltransferase (2.7.7.11)
UDP-glucose-hexose-1-phosphate uridylyltransferase (2.7.7.12)
mannose-1-phosphate guanylyltransferase (2.7.7.13)
ethanolamine-phosphate cytidylyltransferase (2.7.7.14)
choline-phosphate cytidylyltransferase (2.7.7.15)
DNA primase (2.7.7.B16)
ribonuclease (2.7.7.16)
primase (sequence-specific) (2.7.7.B17)
ribonuclease (2.7.7.17)
glucose-1-phosphate cytidylyltransferase (2.7.7.B18)
nicotinate-nucleotide adenylyltransferase (2.7.7.18)
glucose-1-phosphate guanylyltransferase (2.7.7.B19)
polynucleotide adenylyltransferase (2.7.7.19)
glucose-1-phosphate adenylyltransferase (2.7.7.B20)
sRNA nucleotidyl transferase (2.7.7.20)
N-acetylglucosamine 1-phosphate thymidylyltransferase (2.7.7.B21)
tRNA cytidylyltransferase (2.7.7.21)
mannose-1-phosphate guanylyltransferase (GDP) (2.7.7.22)
transposase (2.7.7.B22)
adenosine monophosphate-protein transferase (2.7.7.B23)
UDP-N-acetylglucosamine diphosphorylase (2.7.7.23)
3',5'-cyclic AMP-GMP cyclase (2.7.7.B24)
glucose-1-phosphate thymidylyltransferase (2.7.7.24)
GPI ethanolamine phosphate transferase (2.7.7.B25)
tRNA adenylyltransferase (2.7.7.25)
GPI ethanolamine phosphate transferase 3 (residue Man3 modifying) (2.7.7.B26)
guanyloribonuclease (2.7.7.26)
glucose-1-phosphate adenylyltransferase (2.7.7.27)
nucleoside-triphosphate-aldose-1-phosphate nucleotidyltransferase (2.7.7.28)
hexose-1-phosphate guanylyltransferase (2.7.7.29)
fucose-1-phosphate guanylyltransferase (2.7.7.30)
DNA nucleotidylexotransferase (2.7.7.31)
galactose-1-phosphate thymidylyltransferase (2.7.7.32)
glucose-1-phosphate cytidylyltransferase (2.7.7.33)
glucose-1-phosphate guanylyltransferase (2.7.7.34)
ADP ribose phosphorylase (2.7.7.35)
aldose-1-phosphate adenylyltransferase (2.7.7.36)
aldose-1-phosphate nucleotidyltransferase (2.7.7.37)
3-deoxy-manno-octulosonate cytidylyltransferase (2.7.7.38)
glycerol-3-phosphate cytidylyltransferase (2.7.7.39)
D-ribitol-5-phosphate cytidylyltransferase (2.7.7.40)
phosphatidate cytidylyltransferase (2.7.7.41)
[glutamine synthetase] adenylyltransferase (2.7.7.42)
N-acylneuraminate cytidylyltransferase (2.7.7.43)
glucuronate-1-phosphate uridylyltransferase (2.7.7.44)
guanosine-triphosphate guanylyltransferase (2.7.7.45)
gentamicin 2''-nucleotidyltransferase (2.7.7.46)
streptomycin 3''-adenylyltransferase (2.7.7.47)
RNA-directed RNA polymerase (2.7.7.48)
RNA-directed DNA polymerase (2.7.7.49)
mRNA guanylyltransferase (2.7.7.50)
adenylylsulfate-ammonia adenylyltransferase (2.7.7.51)
RNA uridylyltransferase (2.7.7.52)
ATP adenylyltransferase (2.7.7.53)
phenylalanine adenylyltransferase (2.7.7.54)
anthranilate adenylyltransferase (2.7.7.55)
tRNA nucleotidyltransferase (2.7.7.56)
N-methylphosphoethanolamine cytidylyltransferase (2.7.7.57)
(2,3-dihydroxybenzoyl)adenylate synthase (2.7.7.58)
[protein-PII] uridylyltransferase (2.7.7.59)
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (2.7.7.60)
citrate lyase holo-[acyl-carrier protein] synthase (2.7.7.61)
adenosylcobinamide-phosphate guanylyltransferase (2.7.7.62)
lipoate-protein ligase (2.7.7.63)
UTP-monosaccharide-1-phosphate uridylyltransferase (2.7.7.64)
diguanylate cyclase (2.7.7.65)
malonate decarboxylase holo-[acyl-carrier protein] synthase (2.7.7.66)
CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase (2.7.7.67)
2-phospho-L-lactate guanylyltransferase (2.7.7.68)
GDP-L-galactose/GDP-D-glucose: hexose 1-phosphate guanylyltransferase (2.7.7.69)
D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (2.7.7.70)
D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase (2.7.7.71)
CCA tRNA nucleotidyltransferase (2.7.7.72)
sulfur carrier protein ThiS adenylyltransferase (2.7.7.73)
1L-myo-inositol 1-phosphate cytidylyltransferase (2.7.7.74)
molybdopterin adenylyltransferase (2.7.7.75)
molybdenum cofactor cytidylyltransferase (2.7.7.76)
molybdenum cofactor guanylyltransferase (2.7.7.77)
GDP-D-glucose phosphorylase (2.7.7.78)
tRNAHis guanylyltransferase (2.7.7.79)
molybdopterin-synthase adenylyltransferase (2.7.7.80)
pseudaminic acid cytidylyltransferase (2.7.7.81)
CMP-N,N'-diacetyllegionaminic acid synthase (2.7.7.82)
UDP-N-acetylgalactosamine diphosphorylase (2.7.7.83)
2'-5' oligoadenylate synthase (2.7.7.84)
diadenylate cyclase (2.7.7.85)
cyclic GMP-AMP synthase (2.7.7.86)
L-threonylcarbamoyladenylate synthase (2.7.7.87)
GDP polyribonucleotidyltransferase (2.7.7.88)
[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase (2.7.7.89)
8-amino-3,8-dideoxy-manno-octulosonate cytidylyltransferase (2.7.7.90)
valienol-1-phosphate guanylyltransferase (2.7.7.91)
3-deoxy-D-glycero-D-galacto-nonulopyranosonate cytidylyltransferase (2.7.7.92)
phosphonoformate cytidylyltransferase (2.7.7.93)
4-hydroxyphenylalkanoate adenylyltransferase (2.7.7.94)
mycocerosic acid adenylyltransferase (2.7.7.95)
ADP-D-ribose pyrophosphorylase (2.7.7.96)
3-hydroxy-4-methylanthranilate adenylyltransferase (2.7.7.97)
4-hydroxybenzoate adenylyltransferase (2.7.7.98)
N-acetyl-alpha-D-muramate 1-phosphate uridylyltransferase (2.7.7.99)
SAMP-activating enzyme (2.7.7.100)
DNA primase DnaG (2.7.7.101)
DNA primase AEP (2.7.7.102)
L-glutamine-phosphate cytidylyltransferase (2.7.7.103)
2-hydroxyethylphosphonate cytidylyltransferase (2.7.7.104)
phosphoenolpyruvate guanylyltransferase (2.7.7.105)
3-phospho-D-glycerate guanylyltransferase (2.7.7.106)
(2-aminoethyl)phosphonate cytidylyltransferase (2.7.7.107)
protein adenylyltransferase (2.7.7.108)
ethanolaminephosphotransferase (2.7.8.1)
diacylglycerol cholinephosphotransferase (2.7.8.2)
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (2.7.8.B2)
ceramide cholinephosphotransferase (2.7.8.3)
serine-phosphoethanolamine synthase (2.7.8.4)
CDP-diacylglycerol-glycerol-3-phosphate 1-phosphatidyltransferase (2.7.8.5)
undecaprenyl-phosphate galactose phosphotransferase (2.7.8.6)
holo-[acyl-carrier-protein] synthase (2.7.8.7)
CDP-diacylglycerol-serine O-phosphatidyltransferase (2.7.8.8)
phosphomannan mannosephosphotransferase (2.7.8.9)
cardiolipin synthase A (2.7.8.B10)
sphingosine cholinephosphotransferase (2.7.8.10)
cardiolipin synthase C (2.7.8.B11)
CDP-diacylglycerol-inositol 3-phosphatidyltransferase (2.7.8.11)
teichoic acid poly(glycerol phosphate) polymerase (2.7.8.12)
phosphatidylinositol phosphate synthase (2.7.8.B13)
phospho-N-acetylmuramoyl-pentapeptide-transferase (2.7.8.13)
CDP-ribitol ribitolphosphotransferase (2.7.8.14)
ceramide ethanolamine phosphotransferase (2.7.8.B14)
teichoic acid ribitol-phosphate 1,5-ribitylphospho polymerase (2.7.8.B15)
UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase (2.7.8.15)
1-alkyl-2-acetylglycerol choline phosphotransferase (2.7.8.16)
UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase (2.7.8.17)
UDP-galactose-UDP-N-acetylglucosamine galactose phosphotransferase (2.7.8.18)
UDP-glucose-glycoprotein glucose phosphotransferase (2.7.8.19)
phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase (2.7.8.20)
membrane-oligosaccharide glycerophosphotransferase (2.7.8.21)
1-alkenyl-2-acylglycerol choline phosphotransferase (2.7.8.22)
carboxyvinyl-carboxyphosphonate phosphorylmutase (2.7.8.23)
phosphatidylcholine synthase (2.7.8.24)
triphosphoribosyl-dephospho-CoA synthase (2.7.8.25)
adenosylcobinamide-GDP ribazoletransferase (2.7.8.26)
sphingomyelin synthase (2.7.8.27)
2-phospho-L-lactate transferase (2.7.8.28)
L-serine-phosphatidylethanolamine phosphatidyltransferase (2.7.8.29)
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (2.7.8.30)
undecaprenyl-phosphate glucose phosphotransferase (2.7.8.31)
3-O-alpha-D-mannopyranosyl-alpha-D-mannopyranose xylosylphosphotransferase (2.7.8.32)
UDP-N-acetylglucosamine-undecaprenyl-phosphate N-acetylglucosaminephosphotransferase (2.7.8.33)
CDP-L-myo-inositol myo-inositolphosphotransferase (2.7.8.34)
UDP-N-acetylglucosamine-decaprenyl-phosphate N-acetylglucosaminephosphotransferase (2.7.8.35)
undecaprenyl phosphate N,N'-diacetylbacillosamine 1-phosphate transferase (2.7.8.36)
alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase (2.7.8.37)
archaetidylserine synthase (2.7.8.38)
archaetidylinositol phosphate synthase (2.7.8.39)
UDP-N-acetylgalactosamine-undecaprenyl-phosphate N-acetylgalactosaminephosphotransferase (2.7.8.40)
cardiolipin synthase (CMP-forming) (2.7.8.41)
Kdo2-lipid A phosphoethanolamine 7''-transferase (2.7.8.42)
lipid A phosphoethanolamine transferase (2.7.8.43)
teichoic acid glycerol-phosphate primase (2.7.8.44)
teichoic acid glycerol-phosphate transferase (2.7.8.45)
teichoic acid ribitol-phosphate primase (2.7.8.46)
teichoic acid ribitol-phosphate polymerase (2.7.8.47)
pyruvate, phosphate dikinase (2.7.9.1)
pyruvate, water dikinase (2.7.9.2)
selenide, water dikinase (2.7.9.3)
alpha-glucan, water dikinase (2.7.9.4)
phosphoglucan, water dikinase (2.7.9.5)
rifampicin phosphotransferase (2.7.9.6)
receptor protein-tyrosine kinase (2.7.10.1)
non-specific protein-tyrosine kinase (2.7.10.2)
bacterial tyrosine kinase (2.7.10.3)
non-specific serine/threonine protein kinase (2.7.11.1)
serine/threonine protein kinase ST1565 (2.7.11.B1)
[pyruvate dehydrogenase (acetyl-transferring)] kinase (2.7.11.2)
dephospho-[reductase kinase] kinase (2.7.11.3)
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase (2.7.11.4)
[Isocitrate dehydrogenase (NADP+)] kinase (2.7.11.5)
[tyrosine 3-monooxygenase] kinase (2.7.11.6)
myosin-heavy-chain kinase (2.7.11.7)
Fas-activated serine/threonine kinase (2.7.11.8)
Goodpasture-antigen-binding protein kinase (2.7.11.9)
IkappaB kinase (2.7.11.10)
cAMP-dependent protein kinase (2.7.11.11)
cGMP-dependent protein kinase (2.7.11.12)
protein kinase C (2.7.11.13)
rhodopsin kinase (2.7.11.14)
beta-adrenergic-receptor kinase (2.7.11.15)
G-protein-coupled receptor kinase (2.7.11.16)
Ca2+/calmodulin-dependent protein kinase (2.7.11.17)
myosin-light-chain kinase (2.7.11.18)
phosphorylase kinase (2.7.11.19)
elongation factor 2 kinase (2.7.11.20)
polo kinase (2.7.11.21)
cyclin-dependent kinase (2.7.11.22)
[RNA-polymerase]-subunit kinase (2.7.11.23)
mitogen-activated protein kinase (2.7.11.24)
mitogen-activated protein kinase kinase kinase (2.7.11.25)
tau-protein kinase (2.7.11.26)
[acetyl-CoA carboxylase] kinase (2.7.11.27)
tropomyosin kinase (2.7.11.28)
low-density-lipoprotein receptor kinase (2.7.11.29)
receptor protein serine/threonine kinase (2.7.11.30)
[hydroxymethylglutaryl-CoA reductase (NADPH)] kinase (2.7.11.31)
[pyruvate, phosphate dikinase] kinase (2.7.11.32)
[pyruvate, water dikinase] kinase (2.7.11.33)
NEK6-subfamily protein kinase (2.7.11.34)
dual-specificity kinase (2.7.12.1)
mitogen-activated protein kinase kinase (2.7.12.2)
protein-histidine pros-kinase (2.7.13.1)
protein-histidine tele-kinase (2.7.13.2)
histidine kinase (2.7.13.3)
protein arginine kinase (2.7.14.1)
diadenosine 5',5''''-P1,P4-tetraphosphate synthase (diphosphate-forming) (2.7.99.B1)
triphosphate-protein phosphotransferase (2.7.99.1)
thiosulfate sulfurtransferase (2.8.1.1)
3-mercaptopyruvate sulfurtransferase (2.8.1.2)
tRNA-5-methyluridine54 2-sulfurtransferase (2.8.1.B2)
thiosulfate-thiol sulfurtransferase (2.8.1.3)
tRNA-5-methyluridine54 2-sulfurtransferase (2.8.1.B3)
tRNA uracil 4-sulfurtransferase (2.8.1.4)
thiosulfate-dithiol sulfurtransferase (2.8.1.5)
biotin synthase (2.8.1.6)
cysteine desulfurase (2.8.1.7)
lipoyl synthase (2.8.1.8)
molybdenum cofactor sulfurtransferase (2.8.1.9)
thiazole synthase (2.8.1.10)
molybdopterin synthase sulfurtransferase (2.8.1.11)
molybdopterin synthase (2.8.1.12)
tRNA-uridine 2-sulfurtransferase (2.8.1.13)
tRNA-5-taurinomethyluridine 2-sulfurtransferase (2.8.1.14)
tRNA-5-methyluridine54 2-sulfurtransferase (2.8.1.15)
L-aspartate semialdehyde sulfurtransferase (2.8.1.16)
APS sulfotransferase (2.8.2.B1)
aryl sulfotransferase (2.8.2.1)
alcohol sulfotransferase (2.8.2.2)
amine sulfotransferase (2.8.2.3)
estrone sulfotransferase (2.8.2.4)
chondroitin 4-sulfotransferase (2.8.2.5)
desulfo-A-90289A sulfotransferase (2.8.2.B5)
choline sulfotransferase (2.8.2.6)
[heparan sulfate]-iuronate 2-sulfotransferase (2.8.2.B6)
UDP-N-acetylgalactosamine-4-sulfate sulfotransferase (2.8.2.7)
Vargula-luciferin sulfotransferase (2.8.2.B7)
[heparan sulfate]-glucosamine N-sulfotransferase (2.8.2.8)
tyrosine-ester sulfotransferase (2.8.2.9)
Renilla-luciferin sulfotransferase (2.8.2.10)
galactosylceramide sulfotransferase (2.8.2.11)
heparitin sulfotransferase (2.8.2.12)
psychosine sulfotransferase (2.8.2.13)
bile-salt sulfotransferase (2.8.2.14)
steroid sulfotransferase (2.8.2.15)
thiol sulfotransferase (2.8.2.16)
chondroitin 6-sulfotransferase (2.8.2.17)
cortisol sulfotransferase (2.8.2.18)
triglucosylalkylacylglycerol sulfotransferase (2.8.2.19)
protein-tyrosine sulfotransferase (2.8.2.20)
keratan sulfotransferase (2.8.2.21)
aryl-sulfate sulfotransferase (2.8.2.22)
[heparan sulfate]-glucosamine 3-sulfotransferase 1 (2.8.2.23)
aromatic desulfoglucosinolate sulfotransferase (2.8.2.24)
flavonol 3-sulfotransferase (2.8.2.25)
quercetin-3-sulfate 3'-sulfotransferase (2.8.2.26)
quercetin-3-sulfate 4'-sulfotransferase (2.8.2.27)
quercetin-3,3'-bissulfate 7-sulfotransferase (2.8.2.28)
[heparan sulfate]-glucosamine 3-sulfotransferase 2 (2.8.2.29)
[heparan sulfate]-glucosamine 3-sulfotransferase 3 (2.8.2.30)
petromyzonol sulfotransferase (2.8.2.31)
scymnol sulfotransferase (2.8.2.32)
N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase (2.8.2.33)
glycochenodeoxycholate sulfotransferase (2.8.2.34)
dermatan 4-sulfotransferase (2.8.2.35)
desulfo-A47934 sulfotransferase (2.8.2.36)
trehalose 2-sulfotransferase (2.8.2.37)
aliphatic desulfoglucosinolate sulfotransferase (2.8.2.38)
hydroxyjasmonate sulfotransferase (2.8.2.39)
omega-hydroxy-beta-dihydromenaquinone-9 sulfotransferase (2.8.2.40)
(R)-2-hydroxyisocaproate CoA transferase (2.8.3.B1)
propionate CoA-transferase (2.8.3.1)
oxalate CoA-transferase (2.8.3.2)
malonate CoA-transferase (2.8.3.3)
butyrate CoA-transferase (2.8.3.4)
3-oxoacid CoA-transferase (2.8.3.5)
3-oxoadipate CoA-transferase (2.8.3.6)
succinate-citramalate CoA-transferase (2.8.3.7)
acetate CoA-transferase (2.8.3.8)
butyrate-acetoacetate CoA-transferase (2.8.3.9)
citrate CoA-transferase (2.8.3.10)
citramalate CoA-transferase (2.8.3.11)
glutaconate CoA-transferase (2.8.3.12)
succinate-hydroxymethylglutarate CoA-transferase (2.8.3.13)
5-hydroxypentanoate CoA-transferase (2.8.3.14)
succinyl-CoA:(R)-benzylsuccinate CoA-transferase (2.8.3.15)
formyl-CoA transferase (2.8.3.16)
3-(aryl)acryloyl-CoA:(R)-3-(aryl)lactate CoA-transferase (2.8.3.17)
succinyl-CoA:acetate CoA-transferase (2.8.3.18)
CoA:oxalate CoA-transferase (2.8.3.19)
succinyl-CoA-D-citramalate CoA-transferase (2.8.3.20)
L-carnitine CoA-transferase (2.8.3.21)
succinyl-CoA-L-malate CoA-transferase (2.8.3.22)
caffeate CoA-transferase (2.8.3.23)
(R)-2-hydroxy-4-methylpentanoate CoA-transferase (2.8.3.24)
bile acid CoA-transferase (2.8.3.25)
succinyl-CoA:mesaconate CoA transferase (2.8.3.26)
propanoyl-CoA:succinate CoA transferase (2.8.3.27)
phenylsuccinyl-CoA transferase (2.8.3.28)
coenzyme-B sulfoethylthiotransferase (2.8.4.1)
arsenate-mycothiol transferase (2.8.4.2)
tRNA-2-methylthio-N6-dimethylallyladenosine synthase (2.8.4.3)
[ribosomal protein S12] (aspartate89-C3)-methylthiotransferase (2.8.4.4)
tRNA (N6-L-threonylcarbamoyladenosine37-C2)-methylthiotransferase (2.8.4.5)
S-methyl-1-thioxylulose 5-phosphate methylthiotransferase (2.8.4.6)
S-sulfo-L-cysteine synthase (3-phospho-L-serine-dependent) (2.8.5.1)
L-cysteine S-thiosulfotransferase (2.8.5.2)
L-seryl-tRNASec selenium transferase (2.9.1.1)
O-phospho-L-seryl-tRNASec:L-selenocysteinyl-tRNA synthase (2.9.1.2)
tRNA 2-selenouridine synthase (2.9.1.3)
molybdopterin molybdotransferase (2.10.1.1)
carboxylesterase (3.1.1.1)
arylesterase (3.1.1.2)
triacylglycerol lipase (3.1.1.3)
phospholipase A2 (3.1.1.4)
lysophospholipase (3.1.1.5)
acetylesterase (3.1.1.6)
acetylcholinesterase (3.1.1.7)
cholinesterase (3.1.1.8)
benzoylcholinesterase (3.1.1.9)
p-coumaroyl esterase (3.1.1.B10)
tropinesterase (3.1.1.10)
glucuronoyl esterase (3.1.1.B11)
pectinesterase (3.1.1.11)
vitamin A esterase (3.1.1.12)
zearalenone hydrolase (3.1.1.B12)
ergosteryl-3beta-O-L-aspartate hydrolase (3.1.1.B13)
sterol esterase (3.1.1.13)
chlorophyllase (3.1.1.14)
L-arabinonolactonase (3.1.1.15)
4-carboxymethyl-4-hydroxyisocrotonolactonase (3.1.1.16)
gluconolactonase (3.1.1.17)
aldonolactonase (3.1.1.18)
uronolactonase (3.1.1.19)
tannase (3.1.1.20)
retinyl-palmitate esterase (3.1.1.21)
hydroxybutyrate-dimer hydrolase (3.1.1.22)
acylglycerol lipase (3.1.1.23)
3-oxoadipate enol-lactonase (3.1.1.24)
1,4-lactonase (3.1.1.25)
galactolipase (3.1.1.26)
4-pyridoxolactonase (3.1.1.27)
acylcarnitine hydrolase (3.1.1.28)
aminoacyl-tRNA hydrolase (3.1.1.29)
D-arabinonolactonase (3.1.1.30)
6-phosphogluconolactonase (3.1.1.31)
phospholipase A1 (3.1.1.32)
6-acetylglucose deacetylase (3.1.1.33)
lipoprotein lipase (3.1.1.34)
dihydrocoumarin hydrolase (3.1.1.35)
limonin-D-ring-lactonase (3.1.1.36)
steroid-lactonase (3.1.1.37)
triacetate-lactonase (3.1.1.38)
actinomycin lactonase (3.1.1.39)
orsellinate-depside hydrolase (3.1.1.40)
cephalosporin-C deacetylase (3.1.1.41)
chlorogenate hydrolase (3.1.1.42)
alpha-amino-acid esterase (3.1.1.43)
4-methyloxaloacetate esterase (3.1.1.44)
carboxymethylenebutenolidase (3.1.1.45)
Deoxylimonate A-ring-lactonase (3.1.1.46)
1-alkyl-2-acetylglycerophosphocholine esterase (3.1.1.47)
fusarinine-C ornithinesterase (3.1.1.48)
sinapine esterase (3.1.1.49)
wax-ester hydrolase (3.1.1.50)
phorbol-diester hydrolase (3.1.1.51)
phosphatidylinositol deacylase (3.1.1.52)
sialate O-acetylesterase (3.1.1.53)
acetoxybutynylbithiophene deacetylase (3.1.1.54)
acetylsalicylate deacetylase (3.1.1.55)
methylumbelliferyl-acetate deacetylase (3.1.1.56)
2-pyrone-4,6-dicarboxylate lactonase (3.1.1.57)
N-acetylgalactosaminoglycan deacetylase (3.1.1.58)
juvenile-hormone esterase (3.1.1.59)
bis(2-ethylhexyl)phthalate esterase (3.1.1.60)
protein-glutamate methylesterase (3.1.1.61)
N-acetyldiaminopimelate deacylase (3.1.1.62)
11-cis-retinyl-palmitate hydrolase (3.1.1.63)
retinoid isomerohydrolase (3.1.1.64)
L-rhamnono-1,4-lactonase (3.1.1.65)
5-(3,4-diacetoxybut-1-ynyl)-2,2'-bithiophene deacetylase (3.1.1.66)
fatty-acyl-ethyl-ester synthase (3.1.1.67)
xylono-1,4-lactonase (3.1.1.68)
N-acetylglucosaminylphosphatidylinositol deacetylase (3.1.1.69)
cetraxate benzylesterase (3.1.1.70)
acetylalkylglycerol acetylhydrolase (3.1.1.71)
acetylxylan esterase (3.1.1.72)
feruloyl esterase (3.1.1.73)
cutinase (3.1.1.74)
poly(3-hydroxybutyrate) depolymerase (3.1.1.75)
poly(3-hydroxyoctanoate) depolymerase (3.1.1.76)
acyloxyacyl hydrolase (3.1.1.77)
polyneuridine-aldehyde esterase (3.1.1.78)
hormone-sensitive lipase (3.1.1.79)
acetylajmaline esterase (3.1.1.80)
quorum-quenching N-acyl-homoserine lactonase (3.1.1.81)
pheophorbidase (3.1.1.82)
monoterpene epsilon-lactone hydrolase (3.1.1.83)
cocaine esterase (3.1.1.84)
pimelyl-[acyl-carrier protein] methyl ester esterase (3.1.1.85)
rhamnogalacturonan acetylesterase (3.1.1.86)
fumonisin B1 esterase (3.1.1.87)
pyrethroid hydrolase (3.1.1.88)
protein phosphatase methylesterase-1 (3.1.1.89)
all-trans-retinyl ester 13-cis isomerohydrolase (3.1.1.90)
2-oxo-3-(5-oxofuran-2-ylidene)propanoate lactonase (3.1.1.91)
4-sulfomuconolactone hydrolase (3.1.1.92)
mycophenolic acid acyl-glucuronide esterase (3.1.1.93)
versiconal hemiacetal acetate esterase (3.1.1.94)
aclacinomycin methylesterase (3.1.1.95)
D-aminoacyl-tRNA deacylase (3.1.1.96)
methylated diphthine methylhydrolase (3.1.1.97)
[Wnt protein] O-palmitoleoyl-L-serine hydrolase (3.1.1.98)
6-deoxy-6-sulfogluconolactonase (3.1.1.99)
chlorophyllide a hydrolase (3.1.1.100)
poly(ethylene terephthalate) hydrolase (3.1.1.101)
mono(ethylene terephthalate) hydrolase (3.1.1.102)
teichoic acid D-alanine hydrolase (3.1.1.103)
5-phospho-D-xylono-1,4-lactonase (3.1.1.104)
3-O-acetylpapaveroxine carboxylesterase (3.1.1.105)
O-acetyl-ADP-ribose deacetylase (3.1.1.106)
apo-salmochelin esterase (3.1.1.107)
iron(III)-enterobactin esterase (3.1.1.108)
iron(III)-salmochelin esterase (3.1.1.109)
xylono-1,5-lactonase (3.1.1.110)
phosphatidylserine sn-1 acylhydrolase (3.1.1.111)
isoamyl acetate esteras (3.1.1.112)
ethyl acetate hydrolase (3.1.1.113)
methyl acetate hydrolase (3.1.1.114)
D-apionolactonase (3.1.1.115)
sn-1-specific diacylglycerol lipase (3.1.1.116)
(4-O-methyl)-D-glucuronate---lignin esterase (3.1.1.117)
phospholipid sn-1 acylhydrolase (3.1.1.118)
acetyl-CoA hydrolase (3.1.2.1)
palmitoyl-CoA hydrolase (3.1.2.2)
succinyl-CoA hydrolase (3.1.2.3)
3-hydroxyisobutyryl-CoA hydrolase (3.1.2.4)
3,4-hydroxyphenylacetyl-CoA thioesterase (3.1.2.B5)
hydroxymethylglutaryl-CoA hydrolase (3.1.2.5)
hydroxyacylglutathione hydrolase (3.1.2.6)
glutathione thiolesterase (3.1.2.7)
S-acetoacylglutathione hydrolase (3.1.2.8)
S-acetoacetylhydrolipoate hydrolase (3.1.2.9)
formyl-CoA hydrolase (3.1.2.10)
acetoacetyl-CoA hydrolase (3.1.2.11)
S-formylglutathione hydrolase (3.1.2.12)
S-succinylglutathione hydrolase (3.1.2.13)
oleoyl-[acyl-carrier-protein] hydrolase (3.1.2.14)
ubiquitin thiolesterase (3.1.2.15)
citrate-lyase deacetylase (3.1.2.16)
(S)-methylmalonyl-CoA hydrolase (3.1.2.17)
ADP-dependent short-chain-acyl-CoA hydrolase (3.1.2.18)
ADP-dependent medium-chain-acyl-CoA hydrolase (3.1.2.19)
acyl-CoA hydrolase (3.1.2.20)
dodecanoyl-[acyl-carrier-protein] hydrolase (3.1.2.21)
palmitoyl[protein] hydrolase (3.1.2.22)
4-hydroxybenzoyl-CoA thioesterase (3.1.2.23)
2-(2-hydroxyphenyl)benzenesulfinate hydrolase (3.1.2.24)
phenylacetyl-CoA hydrolase (3.1.2.25)
bile-acid-CoA hydrolase (3.1.2.26)
choloyl-CoA hydrolase (3.1.2.27)
1,4-dihydroxy-2-naphthoyl-CoA hydrolase (3.1.2.28)
fluoroacetyl-CoA thioesterase (3.1.2.29)
(3S)-malyl-CoA thioesterase (3.1.2.30)
dihydromonacolin L-[lovastatin nonaketide synthase] thioesterase (3.1.2.31)
2-aminobenzoylacetyl-CoA thioesterase (3.1.2.32)
alkaline phosphatase (3.1.3.1)
acid phosphatase (3.1.3.2)
phosphoserine phosphatase (3.1.3.3)
phosphatidate phosphatase (3.1.3.4)
phosphatidylinositol-4-phosphate phosphatase (3.1.3.B4)
5'-nucleotidase (3.1.3.5)
3'-nucleotidase (3.1.3.6)
3'(2'),5'-bisphosphate nucleotidase (3.1.3.7)
3-phytase (3.1.3.8)
mannosylglucosyl-3-phosphoglycerate phosphatase (3.1.3.B8)
glucose-6-phosphatase (3.1.3.9)
L-galactose 1-phosphate phosphatase (3.1.3.B9)
glucose-1-phosphatase (3.1.3.10)
fructose-bisphosphatase (3.1.3.11)
trehalose-phosphatase (3.1.3.12)
bisphosphoglycerate phosphatase (3.1.3.13)
sn-2-glycerol-3-phosphate phosphatase (3.1.3.B13)
archaetidylinositol phosphate phosphatase (3.1.3.B14)
methylphosphothioglycerate phosphatase (3.1.3.14)
histidinol-phosphatase (3.1.3.15)
protein-serine/threonine phosphatase (3.1.3.16)
[phosphorylase] phosphatase (3.1.3.17)
phosphoglycolate phosphatase (3.1.3.18)
glycerol-2-phosphatase (3.1.3.19)
phosphoglycerate phosphatase (3.1.3.20)
glycerol-1-phosphatase (3.1.3.21)
mannitol-1-phosphatase (3.1.3.22)
sugar-phosphatase (3.1.3.23)
sucrose-phosphate phosphatase (3.1.3.24)
inositol-phosphate phosphatase (3.1.3.25)
4-phytase (3.1.3.26)
phosphatidylglycerophosphatase (3.1.3.27)
ADP-phosphoglycerate phosphatase (3.1.3.28)
N-acylneuraminate-9-phosphatase (3.1.3.29)
3'-phosphoadenylylsulfate 3'-phosphatase (3.1.3.30)
nucleotidase (3.1.3.31)
polynucleotide 3'-phosphatase (3.1.3.32)
polynucleotide 5'-phosphatase (3.1.3.33)
deoxynucleotide 3'-phosphatase (3.1.3.34)
thymidylate 5'-phosphatase (3.1.3.35)
phosphoinositide 5-phosphatase (3.1.3.36)
sedoheptulose-bisphosphatase (3.1.3.37)
3-phosphoglycerate phosphatase (3.1.3.38)
streptomycin-6-phosphatase (3.1.3.39)
guanidinodeoxy-scyllo-inositol-4-phosphatase (3.1.3.40)
4-nitrophenylphosphatase (3.1.3.41)
[glycogen-synthase-D] phosphatase (3.1.3.42)
[pyruvate dehydrogenase (acetyl-transferring)]-phosphatase (3.1.3.43)
[acetyl-CoA carboxylase]-phosphatase (3.1.3.44)
3-deoxy-manno-octulosonate-8-phosphatase (3.1.3.45)
fructose-2,6-bisphosphate 2-phosphatase (3.1.3.46)
[hydroxymethylglutaryl-CoA reductase (NADPH)]-phosphatase (3.1.3.47)
protein-tyrosine-phosphatase (3.1.3.48)
[pyruvate kinase]-phosphatase (3.1.3.49)
sorbitol-6-phosphatase (3.1.3.50)
dolichyl-phosphatase (3.1.3.51)
[3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)]-phosphatase (3.1.3.52)
[myosin-light-chain] phosphatase (3.1.3.53)
fructose-2,6-bisphosphate 6-phosphatase (3.1.3.54)
caldesmon-phosphatase (3.1.3.55)
inositol-polyphosphate 5-phosphatase (3.1.3.56)
inositol-1,4-bisphosphate 1-phosphatase (3.1.3.57)
sugar-terminal-phosphatase (3.1.3.58)
alkylacetylglycerophosphatase (3.1.3.59)
phosphoenolpyruvate phosphatase (3.1.3.60)
inositol-1,4,5-trisphosphate 1-phosphatase (3.1.3.61)
multiple inositol-polyphosphate phosphatase (3.1.3.62)
2-carboxy-D-arabinitol-1-phosphatase (3.1.3.63)
phosphatidylinositol-3-phosphatase (3.1.3.64)
inositol-1,3-bisphosphate 3-phosphatase (3.1.3.65)
phosphatidylinositol-3,4-bisphosphate 4-phosphatase (3.1.3.66)
phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase (3.1.3.67)
2-deoxyglucose-6-phosphatase (3.1.3.68)
glucosylglycerol 3-phosphatase (3.1.3.69)
mannosyl-3-phosphoglycerate phosphatase (3.1.3.70)
2-phosphosulfolactate phosphatase (3.1.3.71)
5-phytase (3.1.3.72)
adenosylcobalamin/alpha-ribazole phosphatase (3.1.3.73)
pyridoxal phosphatase (3.1.3.74)
phosphoethanolamine/phosphocholine phosphatase (3.1.3.75)
lipid-phosphate phosphatase (3.1.3.76)
acireductone synthase (3.1.3.77)
phosphatidylinositol-4,5-bisphosphate 4-phosphatase (3.1.3.78)
mannosylfructose-phosphate phosphatase (3.1.3.79)
2,3-bisphosphoglycerate 3-phosphatase (3.1.3.80)
diacylglycerol diphosphate phosphatase (3.1.3.81)
D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase (3.1.3.82)
D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase (3.1.3.83)
ADP-ribose 1''-phosphate phosphatase (3.1.3.84)
glucosyl-3-phosphoglycerate phosphatase (3.1.3.85)
phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (3.1.3.86)
2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase (3.1.3.87)
5''-phosphoribostamycin phosphatase (3.1.3.88)
5'-deoxynucleotidase (3.1.3.89)
maltose 6'-phosphate phosphatase (3.1.3.90)
7-methylguanosine nucleotidase (3.1.3.91)
kanosamine-6-phosphate phosphatase (3.1.3.92)
L-galactose 1-phosphate phosphatase (3.1.3.93)
D-galactose 1-phosphate phosphatase (3.1.3.94)
phosphatidylinositol-3,5-bisphosphate 3-phosphatase (3.1.3.95)
pseudouridine 5'-phosphatase (3.1.3.96)
3',5'-nucleoside bisphosphate phosphatase (3.1.3.97)
CDP-glycerol:N-acetyl-beta-D-mannosaminyl-(1->4)-N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol glycerophosphotransferase (3.1.3.98)
IMP-specific 5'-nucleotidase (3.1.3.99)
thiamine phosphate phosphatase (3.1.3.100)
validoxylamine A 7'-phosphate phosphatase (3.1.3.101)
FMN hydrolase (3.1.3.102)
3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphatase (3.1.3.103)
5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase (3.1.3.104)
N-acetyl-D-muramate 6-phosphate phosphatase (3.1.3.105)
2-lysophosphatidate phosphatase (3.1.3.106)
amicoumacin phosphatase (3.1.3.107)
nocturnin (3.1.3.108)
phosphodiesterase I (3.1.4.1)
glycerophosphocholine phosphodiesterase (3.1.4.2)
phospholipase C (3.1.4.3)
phospholipase D (3.1.4.4)
UDP-alpha-D-glucose glucohydrolase (3.1.4.B4)
deoxyribonuclease (3.1.4.5)
deoxyribonuclease II (3.1.4.6)
micrococcal nuclease (3.1.4.7)
Aspergillus oryzae ribonuclease (3.1.4.8)
nucleate endonuclease (3.1.4.9)
1-phosphatidylinositol phosphodiesterase (3.1.4.10)
phosphoinositide phospholipase C (3.1.4.11)
sphingomyelin phosphodiesterase (3.1.4.12)
serine-ethanolaminephosphate phosphodiesterase (3.1.4.13)
[acyl-carrier-protein] phosphodiesterase (3.1.4.14)
adenylyl-[glutamate-ammonia ligase] hydrolase (3.1.4.15)
2',3'-cyclic-nucleotide 2'-phosphodiesterase (3.1.4.16)
3',5'-cyclic-nucleotide phosphodiesterase (3.1.4.17)
phosphodiesterase II (3.1.4.18)
oligonucleotidase (3.1.4.19)
exoribonuclease (3.1.4.20)
single-stranded-nucleate endonuclease (3.1.4.21)
ribonuclease I (3.1.4.22)
ribonuclease II (3.1.4.23)
endoribonuclease III (3.1.4.24)
exodeoxyribonuclease I (3.1.4.25)
exodeoxyribonuclease II (3.1.4.26)
exodeoxyribonuclease II (3.1.4.27)
exodeoxyribonuclease IV (3.1.4.28)
oligodeoxyribonucleate exonuclease (3.1.4.29)
endodeoxyribonuclease (3.1.4.30)
DNA 5'-dinucleotidohydrolase (3.1.4.31)
endodeoxyribonuclease (ATP- and S-adenosylmethionine-dependent) (3.1.4.32)
endodeoxyribonuclease (ATP-hydrolysing) (3.1.4.33)
hybrid nuclease (3.1.4.34)
3',5'-cyclic-GMP phosphodiesterase (3.1.4.35)
1,2-cyclic-inositol-phosphate phosphodiesterase (3.1.4.36)
2',3'-cyclic-nucleotide 3'-phosphodiesterase (3.1.4.37)
glycerophosphocholine cholinephosphodiesterase (3.1.4.38)
alkylglycerophosphoethanolamine phosphodiesterase (3.1.4.39)
CMP-N-acylneuraminate phosphodiesterase (3.1.4.40)
sphingomyelin phosphodiesterase D (3.1.4.41)
glycerol-1,2-cyclic-phosphate 2-phosphodiesterase (3.1.4.42)
glycerophosphoinositol inositolphosphodiesterase (3.1.4.43)
glycerophosphoinositol glycerophosphodiesterase (3.1.4.44)
N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase (3.1.4.45)
glycerophosphodiester phosphodiesterase (3.1.4.46)
variant-surface-glycoprotein phospholipase C (3.1.4.47)
dolichylphosphate-glucose phosphodiesterase (3.1.4.48)
dolichylphosphate-mannose phosphodiesterase (3.1.4.49)
glycosylphosphatidylinositol phospholipase D (3.1.4.50)
glucose-1-phospho-D-mannosylglycoprotein phosphodiesterase (3.1.4.51)
cyclic-guanylate-specific phosphodiesterase (3.1.4.52)
3',5'-cyclic-AMP phosphodiesterase (3.1.4.53)
N-acetylphosphatidylethanolamine-hydrolysing phospholipase D (3.1.4.54)
phosphoribosyl 1,2-cyclic phosphate phosphodiesterase (3.1.4.55)
7,8-dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase (3.1.4.56)
phosphoribosyl 1,2-cyclic phosphate 1,2-diphosphodiesterase (3.1.4.57)
RNA 2',3'-cyclic 3'-phosphodiesterase (3.1.4.58)
cyclic-di-AMP phosphodiesterase (3.1.4.59)
pApA phosphodiesterase (3.1.4.60)
cyclic 2,3-diphosphoglycerate hydrolase (3.1.4.61)
dGTPase (3.1.5.1)
dNTPase (3.1.5.B1)
arylsulfatase (type I) (3.1.6.1)
fucoidan-2-sulfatase (3.1.6.B2)
steryl-sulfatase (3.1.6.2)
glycosulfatase (3.1.6.3)
N-acetylgalactosamine-6-sulfatase (3.1.6.4)
sinigrin sulfohydrolase; myrosulfatase (3.1.6.5)
choline-sulfatase (3.1.6.6)
cellulose-polysulfatase (3.1.6.7)
cerebroside-sulfatase (3.1.6.8)
chondro-4-sulfatase (3.1.6.9)
chondro-6-sulfatase (3.1.6.10)
disulfoglucosamine-6-sulfatase (3.1.6.11)
N-acetylgalactosamine-4-sulfatase (3.1.6.12)
iduronate-2-sulfatase (3.1.6.13)
N-acetylglucosamine-6-sulfatase (3.1.6.14)
N-sulfoglucosamine-3-sulfatase (3.1.6.15)
monomethyl-sulfatase (3.1.6.16)
D-lactate-2-sulfatase (3.1.6.17)
glucuronate-2-sulfatase (3.1.6.18)
(R)-specific secondary-alkylsulfatase (type III) (3.1.6.19)
S-sulfosulfanyl-L-cysteine sulfohydrolase (3.1.6.20)
linear primary-alkylsulfatase (3.1.6.21)
branched primary-alkylsulfatase (3.1.6.22)
prenyl-diphosphatase (3.1.7.1)
guanosine-3',5'-bis(diphosphate) 3'-diphosphatase (3.1.7.2)
monoterpenyl-diphosphatase (3.1.7.3)
sclareol cyclase (3.1.7.4)
geranylgeranyl diphosphate diphosphatase (3.1.7.5)
farnesyl diphosphatase (3.1.7.6)
drimenol synthase (3.1.7.7)
tuberculosinol synthase (3.1.7.8)
isotuberculosinol synthase (3.1.7.9)
(13E)-labda-7,13-dien-15-ol synthase (3.1.7.10)
geranyl diphosphate diphosphatase (3.1.7.11)
(+)-kolavelool synthase (3.1.7.12)
neryl diphosphate diphosphatase (3.1.7.13)
aryldialkylphosphatase (3.1.8.1)
diisopropyl-fluorophosphatase (3.1.8.2)
exodeoxyribonuclease I (3.1.11.1)
exodeoxyribonuclease III (3.1.11.2)
exodeoxyribonuclease (lambda-induced) (3.1.11.3)
exodeoxyribonuclease (phage SP3-induced) (3.1.11.4)
exodeoxyribonuclease V (3.1.11.5)
exodeoxyribonuclease VII (3.1.11.6)
adenosine-5'-diphospho-5'-[DNA] diphosphatase (3.1.11.7)
guanosine-5'-diphospho-5'-[DNA] diphosphatase (3.1.11.8)
5' to 3' exodeoxyribonuclease (nucleoside 3'-phosphate-forming) (3.1.12.1)
DNA-3'-diphospho-5'-guanosine diphosphatase (3.1.12.2)
5'-3' exoribonuclease (3.1.13.B1)
exoribonuclease II (3.1.13.1)
exoribonuclease H (3.1.13.2)
oligonucleotidase (3.1.13.3)
poly(A)-specific ribonuclease (3.1.13.4)
ribonuclease D (3.1.13.5)
yeast ribonuclease (3.1.14.1)
NrnC nuclease (3.1.15.B1)
venom exonuclease (3.1.15.1)
spleen exonuclease (3.1.16.1)
deoxyribonuclease I (3.1.21.1)
endonuclease Q (3.1.21.B1)
deoxyribonuclease IV (3.1.21.2)
restriction endonuclease PabI (3.1.21.B2)
mismatch-specific endonuclease (3.1.21.B3)
type I site-specific deoxyribonuclease (3.1.21.3)
type II site-specific deoxyribonuclease (3.1.21.4)
type III site-specific deoxyribonuclease (3.1.21.5)
CC-preferring endodeoxyribonuclease (3.1.21.6)
deoxyribonuclease V (3.1.21.7)
T4 deoxyribonuclease II (3.1.21.8)
T4 deoxyribonuclease IV (3.1.21.9)
crossover junction endodeoxyribonuclease (3.1.21.10)
deoxyribonuclease II (3.1.22.1)
Aspergillus deoxyribonuclease K1 (3.1.22.2)
deoxyribonuclease V (3.1.22.3)
crossover junction endodeoxyribonuclease (3.1.22.4)
deoxyribonuclease X (3.1.22.5)
deoxyribonuclease (pyrimidine dimer) (3.1.25.1)
endodeoxyribonuclease (apurinic or apyrimidinic) (3.1.25.2)
Physarum polycephalum ribonuclease (3.1.26.1)
ribonuclease alpha (3.1.26.2)
ribonuclease III (3.1.26.3)
ribonuclease H (3.1.26.4)
ribonuclease P (3.1.26.5)
ribonuclease IV (3.1.26.6)
ribonuclease P4 (3.1.26.7)
ribonuclease M5 (3.1.26.8)
ribonuclease [poly-(U)-specific] (3.1.26.9)
ribonuclease IX (3.1.26.10)
tRNase Z (3.1.26.11)
ribonuclease E (3.1.26.12)
retroviral ribonuclease H (3.1.26.13)
pre-mRNA splicing endonuclease EndA (3.1.27.B1)
ribonuclease T2 (3.1.27.1)
Bacillus subtilis ribonuclease (3.1.27.2)
ribonuclease T1 (3.1.27.3)
ribonuclease U2 (3.1.27.4)
pancreatic ribonuclease (3.1.27.5)
Enterobacter ribonuclease (3.1.27.6)
ribonuclease F (3.1.27.7)
Ribonuclease V (3.1.27.8)
tRNA-intron endonuclease (3.1.27.9)
rRNA endonuclease (3.1.27.10)
Aspergillus nuclease S1 (3.1.30.1)
Serratia marcescens nuclease (3.1.30.2)
micrococcal nuclease (3.1.31.1)
flap endonuclease-1 (3.1.99.B1)
XPF endonuclease (3.1.99.B2)
Hef endonuclease (3.1.99.B3)
DNase xthA (3.1.99.B4)
endonuclease SSO2001 (3.1.99.B5)
endonuclease Bax1 (3.1.99.B6)
alpha-amylase (3.2.1.1)
extracellular agarase (3.2.1.B1)
beta-amylase (3.2.1.2)
glucan 1,4-alpha-glucosidase (3.2.1.3)
sucrose 6-phosphate hydrolase (3.2.1.B3)
cellulase (3.2.1.4)
licheninase (3.2.1.5)
endo-1,3(4)-beta-glucanase (3.2.1.6)
inulinase (3.2.1.7)
endo-1,4-beta-xylanase (3.2.1.8)
malto-alpha-amylase (reducing end) (3.2.1.B8)
amylopectin-1,6-glucosidase (3.2.1.9)
oligo-1,6-glucosidase (3.2.1.10)
dextranase (3.2.1.11)
cycloheptaglucanase (3.2.1.12)
cyclohexaglucanase (3.2.1.13)
chitinase (3.2.1.14)
endo-polygalacturonase (3.2.1.15)
alginase (3.2.1.16)
ipecoside beta-D-glucosidase (3.2.1.B16)
lysozyme (3.2.1.17)
exo-alpha-sialidase (3.2.1.18)
heparinase (3.2.1.19)
alpha-glucosidase (3.2.1.20)
beta-glucosidase (3.2.1.21)
alpha-galactosidase (3.2.1.22)
beta-galactosidase (3.2.1.23)
ginsenosidase type II (3.2.1.B23)
alpha-mannosidase (3.2.1.24)
beta-mannosidase (3.2.1.25)
beta-fructofuranosidase (3.2.1.26)
Sulfolobus solfataricus beta-glycosidase (3.2.1.B26)
alpha-1,3-glucosidase (3.2.1.27)
alpha,alpha-trehalase (3.2.1.28)
Pyrococcus furiosus beta-glycosidase (3.2.1.B28)
chitobiase (3.2.1.29)
beta-D-acetylglucosaminidase (3.2.1.30)
beta-glucuronidase (3.2.1.31)
beta-rutinosidase (3.2.1.B31)
endo-1,3-beta-xylanase (3.2.1.32)
kojibiose hydrolase (3.2.1.B32)
amylo-alpha-1,6-glucosidase (3.2.1.33)
Sulfolobus shibatae beta-glycosidase (3.2.1.B33)
chondroitinase (3.2.1.34)
Sulfolobus acidocaldarius beta-glycosidase (3.2.1.B34)
hyaluronoglucosaminidase (3.2.1.35)
Thermococcus kodakaraensis beta-glycosidase (3.2.1.B35)
hyaluronoglucuronidase (3.2.1.36)
maltose-forming alpha-amylase (3.2.1.B36)
N-acetylmuramoyl-glycoprotein endo-beta-N-acetylglucosaminidase (3.2.1.B37)
xylan 1,4-beta-xylosidase (3.2.1.37)
beta-D-fucosidase (3.2.1.38)
glucan endo-1,3-beta-D-glucosidase (3.2.1.39)
alpha-L-rhamnosidase (3.2.1.40)
Pyrococcus horikoshii beta-glycosidase (3.2.1.B40)
pullulanase (3.2.1.41)
Thermus thermophilus beta-glycosidase (3.2.1.B41)
cellulose 1,4-beta-cellotetraosidase (non-reducing end) (3.2.1.B42)
GDP-glucosidase (3.2.1.42)
beta-L-rhamnosidase (3.2.1.43)
keratanase II (3.2.1.B43)
fucoidanase (3.2.1.44)
glycyrrhizin glucuronohydrolase (glycyrrhetinic acid 3-O-beta-D-glucuronide-forming) (3.2.1.B44)
glucosylceramidase (3.2.1.45)
galactosylceramidase (3.2.1.46)
exo-fucoidanase (3.2.1.B47)
galactosylgalactosylglucosylceramidase (3.2.1.47)
(Ara-f)4-Hyp alpha-L-arabinofuranosidase (3.2.1.B48)
sucrose alpha-glucosidase (3.2.1.48)
alpha-N-acetylgalactosaminidase (3.2.1.49)
alpha-N-acetylglucosaminidase (3.2.1.50)
alpha-L-fucosidase (3.2.1.51)
beta-N-acetylhexosaminidase (3.2.1.52)
beta-N-acetylgalactosaminidase (3.2.1.53)
cyclomaltodextrinase (3.2.1.54)
non-reducing end alpha-L-arabinofuranosidase (3.2.1.55)
glucuronosyl-disulfoglucosamine glucuronidase (3.2.1.56)
isopullulanase (3.2.1.57)
glucan 1,3-beta-glucosidase (3.2.1.58)
glucan endo-1,3-alpha-glucosidase (3.2.1.59)
glucan 1,4-alpha-maltotetraohydrolase (3.2.1.60)
mycodextranase (3.2.1.61)
glycosylceramidase (3.2.1.62)
1,2-alpha-L-fucosidase (3.2.1.63)
2,6-beta-fructan 6-levanbiohydrolase (3.2.1.64)
levanase (3.2.1.65)
quercitrinase (3.2.1.66)
galacturonan 1,4-alpha-galacturonidase (3.2.1.67)
isoamylase (3.2.1.68)
amylopectin 6-glucanohydrolase (3.2.1.69)
glucan 1,6-alpha-glucosidase (3.2.1.70)
glucan endo-1,2-beta-glucosidase (3.2.1.71)
xylan 1,3-beta-xylosidase (3.2.1.72)
licheninase (3.2.1.73)
glucan 1,4-beta-glucosidase (3.2.1.74)
glucan endo-1,6-beta-glucosidase (3.2.1.75)
L-iduronidase (3.2.1.76)
mannan 1,2-(1,3)-alpha-mannosidase (3.2.1.77)
mannan endo-1,4-beta-mannosidase (3.2.1.78)
alpha-L-arabinofuranoside hydrolase (3.2.1.79)
fructan beta-fructosidase (3.2.1.80)
beta-agarase (3.2.1.81)
exo-poly-alpha-digalacturonosidase (3.2.1.82)
kappa-carrageenase (3.2.1.83)
glucan 1,3-alpha-glucosidase (3.2.1.84)
6-phospho-beta-galactosidase (3.2.1.85)
6-phospho-beta-glucosidase (3.2.1.86)
capsular-polysaccharide endo-1,3-alpha-galactosidase (3.2.1.87)
non-reducing end beta-L-arabinopyranosidase (3.2.1.88)
arabinogalactan endo-beta-1,4-galactanase (3.2.1.89)
arabinogalactan endo-1,3-beta-galactosidase (3.2.1.90)
cellulose 1,4-beta-cellobiosidase (non-reducing end) (3.2.1.91)
peptidoglycan beta-N-acetylmuramidase (3.2.1.92)
alpha,alpha-phosphotrehalase (3.2.1.93)
glucan 1,6-alpha-isomaltosidase (3.2.1.94)
dextran 1,6-alpha-isomaltotriosidase (3.2.1.95)
mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (3.2.1.96)
endo-alpha-N-acetylgalactosaminidase (3.2.1.97)
glucan 1,4-alpha-maltohexaosidase (3.2.1.98)
arabinan endo-1,5-alpha-L-arabinanase (3.2.1.99)
mannan 1,4-mannobiosidase (3.2.1.100)
mannan endo-1,6-alpha-mannosidase (3.2.1.101)
blood-group-substance endo-1,4-beta-galactosidase (3.2.1.102)
keratan-sulfate endo-1,4-beta-galactosidase (3.2.1.103)
steryl-beta-glucosidase (3.2.1.104)
3alpha(S)-strictosidine beta-glucosidase (3.2.1.105)
mannosyl-oligosaccharide glucosidase (3.2.1.106)
protein-glucosylgalactosylhydroxylysine glucosidase (3.2.1.107)
lactase (3.2.1.108)
endogalactosaminidase (3.2.1.109)
mucinaminylserine mucinaminidase (3.2.1.110)
1,3-alpha-L-fucosidase (3.2.1.111)
2-deoxyglucosidase (3.2.1.112)
mannosyl-oligosaccharide 1,2-alpha-mannosidase (3.2.1.113)
mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase (3.2.1.114)
branched-dextran exo-1,2-alpha-glucosidase (3.2.1.115)
glucan 1,4-alpha-maltotriohydrolase (3.2.1.116)
amygdalin beta-glucosidase (3.2.1.117)
prunasin beta-glucosidase (3.2.1.118)
vicianin beta-glucosidase (3.2.1.119)
oligoxyloglucan beta-glycosidase (3.2.1.120)
polymannuronate hydrolase (3.2.1.121)
maltose-6'-phosphate glucosidase (3.2.1.122)
endoglycosylceramidase (3.2.1.123)
3-deoxy-2-octulosonidase (3.2.1.124)
raucaffricine beta-glucosidase (3.2.1.125)
coniferin beta-glucosidase (3.2.1.126)
1,6-alpha-L-fucosidase (3.2.1.127)
glycyrrhizin hydrolase (3.2.1.128)
endo-alpha-sialidase (3.2.1.129)
glycoprotein endo-alpha-1,2-mannosidase (3.2.1.130)
xylan alpha-1,2-glucuronosidase (3.2.1.131)
chitosanase (3.2.1.132)
glucan 1,4-alpha-maltohydrolase (3.2.1.133)
difructose-dianhydride-I hydrolase (3.2.1.134)
neopullulanase (3.2.1.135)
glucuronoarabinoxylan endo-1,4-beta-xylanase (3.2.1.136)
mannan exo-1,2-1,6-alpha-mannosidase (3.2.1.137)
anhydrosialidase (3.2.1.138)
alpha-glucuronidase (3.2.1.139)
lacto-N-biosidase (3.2.1.140)
4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (3.2.1.141)
limit dextrinase (3.2.1.142)
poly(ADP-ribose) glycohydrolase (3.2.1.143)
3-deoxyoctulosonase (3.2.1.144)
galactan 1,3-beta-galactosidase (3.2.1.145)
beta-galactofuranosidase (3.2.1.146)
thioglucosidase (3.2.1.147)
ribosylhomocysteinase (3.2.1.148)
beta-primeverosidase (3.2.1.149)
oligoxyloglucan reducing-end-specific cellobiohydrolase (3.2.1.150)
xyloglucan-specific endo-beta-1,4-glucanase (3.2.1.151)
mannosylglycoprotein endo-beta-mannosidase (3.2.1.152)
fructan beta-(2,1)-fructosidase (3.2.1.153)
fructan beta-(2,6)-fructosidase (3.2.1.154)
xyloglucan-specific exo-beta-1,4-glucanase (3.2.1.155)
oligosaccharide reducing-end xylanase (3.2.1.156)
iota-carrageenase (3.2.1.157)
alpha-agarase (3.2.1.158)
alpha-neoagaro-oligosaccharide hydrolase (3.2.1.159)
xyloglucan-specific exo-beta-1,4-glucanase (3.2.1.160)
beta-apiosyl-beta-glucosidase (3.2.1.161)
lambda-carrageenase (3.2.1.162)
1,6-alpha-D-mannosidase (3.2.1.163)
galactan endo-1,6-beta-galactosidase (3.2.1.164)
exo-1,4-beta-D-glucosaminidase (3.2.1.165)
heparanase (3.2.1.166)
baicalin-beta-D-glucuronidase (3.2.1.167)
hesperidin 6-O-alpha-L-rhamnosyl-beta-D-glucosidase (3.2.1.168)
protein O-GlcNAcase (3.2.1.169)
mannosylglycerate hydrolase (3.2.1.170)
rhamnogalacturonan hydrolase (3.2.1.171)
unsaturated rhamnogalacturonyl hydrolase (3.2.1.172)
rhamnogalacturonan galacturonohydrolase (3.2.1.173)
rhamnogalacturonan rhamnohydrolase (3.2.1.174)
beta-D-glucopyranosyl abscisate beta-glucosidase (3.2.1.175)
cellulose 1,4-beta-cellobiosidase (reducing end) (3.2.1.176)
alpha-D-xyloside xylohydrolase (3.2.1.177)
beta-porphyranase (3.2.1.178)
gellan tetrasaccharide unsaturated glucuronosyl hydrolase (3.2.1.179)
unsaturated chondroitin disaccharide hydrolase (3.2.1.180)
galactan endo-beta-1,3-galactanase (3.2.1.181)
4-hydroxy-7-methoxy-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-2-yl glucoside beta-D-glucosidase (3.2.1.182)
UDP-N-acetylglucosamine 2-epimerase (hydrolysing) (3.2.1.183)
UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolysing) (3.2.1.184)
non-reducing end beta-L-arabinofuranosidase (3.2.1.185)
protodioscin 26-O-beta-D-glucosidase (3.2.1.186)
(Ara-f)3-Hyp beta-L-arabinobiosidase (3.2.1.187)
avenacosidase (3.2.1.188)
dioscin glycosidase (diosgenin-forming) (3.2.1.189)
dioscin glycosidase (3-O-beta-D-Glc-diosgenin-forming) (3.2.1.190)
ginsenosidase type III (3.2.1.191)
ginsenoside Rb1 beta-glucosidase (3.2.1.192)
ginsenosidase type I (3.2.1.193)
ginsenosidase type IV (3.2.1.194)
20-O-multi-glycoside ginsenosidase (3.2.1.195)
limit dextrin alpha-1,6-maltotetraose-hydrolase (3.2.1.196)
beta-1,2-mannosidase (3.2.1.197)
alpha-mannan endo-1,2-alpha-mannanase (3.2.1.198)
sulfoquinovosidase (3.2.1.199)
exo-chitinase (non-reducing end) (3.2.1.200)
exo-chitinase (reducing end) (3.2.1.201)
endo-chitodextinase (3.2.1.202)
carboxymethylcellulase (3.2.1.203)
1,3-alpha-isomaltosidase (3.2.1.204)
isomaltose glucohydrolase (3.2.1.205)
oleuropein beta-glucosidase (3.2.1.206)
mannosyl-oligosaccharide alpha-1,3-glucosidase (3.2.1.207)
glucosylglycerate hydrolase (3.2.1.208)
endoplasmic reticulum Man9GlcNAc2 1,2-alpha-mannosidase (3.2.1.209)
endoplasmic reticulum Man8GlcNAc2 1,2-alpha-mannosidase (3.2.1.210)
endo-(1->3)-fucoidanase (3.2.1.211)
endo-(1->4)-fucoidanase (3.2.1.212)
galactan exo-1,6-beta-galactobiohydrolase (non-reducing end) (3.2.1.213)
exo beta-1,2-glucooligosaccharide sophorohydrolase (non-reducing end) (3.2.1.214)
arabinogalactan exo alpha-(1,3)-alpha-D-galactosyl-(1->3)-L-arabinofuranosidase (non-reducing end) (3.2.1.215)
kojibiose hydrolase (3.2.1.216)
exo-acting protein-alpha-N-acetylgalactosaminidase (3.2.1.217)
purine nucleosidase (3.2.2.1)
inosine nucleosidase (3.2.2.2)
uridine nucleosidase (3.2.2.3)
AMP nucleosidase (3.2.2.4)
8-oxoguanine DNA glycosylase (3.2.2.B5)
NAD+ glycohydrolase (3.2.2.5)
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase (3.2.2.6)
[protein ADP-ribosylaspartate] hydrolase (3.2.2.B6)
adenosine nucleosidase (3.2.2.7)
ribosylpyrimidine nucleosidase (3.2.2.8)
adenosylhomocysteine nucleosidase (3.2.2.9)
pyrimidine-5'-nucleotide nucleosidase (3.2.2.10)
beta-aspartyl-N-acetylglucosaminidase (3.2.2.11)
inosinate nucleosidase (3.2.2.12)
1-methyladenosine nucleosidase (3.2.2.13)
NMN nucleosidase (3.2.2.14)
DNA-deoxyinosine glycosylase (3.2.2.15)
methylthioadenosine nucleosidase (3.2.2.16)
deoxyribodipyrimidine endonucleosidase (3.2.2.17)
glycopeptide N-glycosidase (3.2.2.18)
[protein ADP-ribosylarginine] hydrolase (3.2.2.19)
DNA-3-methyladenine glycosylase I (3.2.2.20)
DNA-3-methyladenine glycosylase II (3.2.2.21)
rRNA N-glycosylase (3.2.2.22)
DNA-formamidopyrimidine glycosylase (3.2.2.23)
ADP-ribosyl-[dinitrogen reductase] hydrolase (3.2.2.24)
N-methyl nucleosidase (3.2.2.25)
futalosine hydrolase (3.2.2.26)
uracil-DNA glycosylase (3.2.2.27)
double-stranded uracil-DNA glycosylase (3.2.2.28)
thymine-DNA glycosylase (3.2.2.29)
aminodeoxyfutalosine nucleosidase (3.2.2.30)
adenine glycosylase (3.2.2.31)
thioglucosidase (3.2.3.1)
adenosylhomocysteinase (3.3.1.1)
inosylhomocysteinase (3.3.1.B1)
S-adenosyl-L-methionine hydrolase (L-homoserine-forming) (3.3.1.2)
ribosylhomocysteinase (3.3.1.3)
2-amino-2-deoxyisochorismate hydrolase (3.3.2.B1)
isochorismatase (3.3.2.1)
lysoplasmalogenase (3.3.2.2)
epoxide hydrolase (3.3.2.3)
trans-epoxysuccinate hydrolase (3.3.2.4)
alkenylglycerophosphoethanolamine hydrolase (3.3.2.5)
leukotriene-A4 hydrolase (3.3.2.6)
hepoxilin-epoxide hydrolase (3.3.2.7)
limonene-1,2-epoxide hydrolase (3.3.2.8)
microsomal epoxide hydrolase (3.3.2.9)
soluble epoxide hydrolase (3.3.2.10)
cholesterol-5,6-oxide hydrolase (3.3.2.11)
oxepin-CoA hydrolase (3.3.2.12)
chorismatase (3.3.2.13)
2,4-dinitroanisole O-demethylase (3.3.2.14)
trans-2,3-dihydro-3-hydroxyanthranilic acid synthase (3.3.2.15)
leucine aminopeptidase (3.4.1.1)
aminopeptidase (3.4.1.2)
aminotripeptidase (3.4.1.3)
proline iminopeptidase (3.4.1.4)
carboxypeptidase A (3.4.2.1)
carboxypeptidase B (3.4.2.2)
yeast carboxypeptidase (3.4.2.3)
glycyl-glycine dipeptidase (3.4.3.1)
glycyl-leucine dipeptidase (3.4.3.2)
aminoacyl-histidine dipeptidase, carnosinase (3.4.3.3)
aminoacyl-methylhistidine dipeptidase, anserinase (3.4.3.4)
cysteinyl-glycine dipeptidase (3.4.3.5)
iminodipeptidase (3.4.3.6)
imidodipeptidase, prolidase (3.4.3.7)
pepsin (3.4.4.1)
pepsin B (3.4.4.2)
rennin (3.4.4.3)
trypsin (3.4.4.4)
chymotrypsin (3.4.4.5)
chymotrypsin B (3.4.4.6)
pancreatopeptidase E (3.4.4.7)
enteropeptidase (3.4.4.8)
cathepsin C (3.4.4.9)
papain (3.4.4.10)
chymopapain (3.4.4.11)
ficin (3.4.4.12)
thrombin (3.4.4.13)
plasmin (3.4.4.14)
renin (3.4.4.15)
subtilopeptidase A (3.4.4.16)
aspergillopeptidase A (3.4.4.17)
streptococcus peptidase A (3.4.4.18)
clostridiopeptidase A (3.4.4.19)
clostridiopeptidase B (3.4.4.20)
kallikrein (3.4.4.21)
recommended Name never specified (3.4.4.22)
recommended Name never specified (3.4.4.23)
recommended Name never specified (3.4.4.24)
keratinase (3.4.4.25)
leucyl aminopeptidase (3.4.11.1)
membrane alanyl aminopeptidase (3.4.11.2)
cystinyl aminopeptidase (3.4.11.3)
Sulfolobus solfataricus aminopeptidase (3.4.11.B3)
Pyrococcus horikoshii deblocking aminopeptidase (3.4.11.B4)
tripeptide aminopeptidase (3.4.11.4)
prolyl aminopeptidase (3.4.11.5)
Thermococcus onnurineus deblocking aminopeptidase (3.4.11.B5)
aminopeptidase B (3.4.11.6)
Thermococcus kodakarensis deblocking aminopeptidase (3.4.11.B6)
arginyl aminopeptidase PH1704 (3.4.11.B7)
glutamyl aminopeptidase (3.4.11.7)
aminopeptidase TET1 (3.4.11.B8)
pyroglutamyl aminopeptidase (3.4.11.8)
TET2 peptidase (3.4.11.B9)
Xaa-Pro aminopeptidase (3.4.11.9)
bacterial leucyl aminopeptidase (3.4.11.10)
aminopeptidase (3.4.11.11)
thermophilic aminopeptidase (3.4.11.12)
Clostridial aminopeptidase (3.4.11.13)
cytosol alanyl aminopeptidase (3.4.11.14)
aminopeptidase Y (3.4.11.15)
Xaa-Trp aminopeptidase (3.4.11.16)
tryptophanyl aminopeptidase (3.4.11.17)
methionyl aminopeptidase (3.4.11.18)
D-stereospecific aminopeptidase (3.4.11.19)
aminopeptidase Ey (3.4.11.20)
aspartyl aminopeptidase (3.4.11.21)
aminopeptidase I (3.4.11.22)
PepB aminopeptidase (3.4.11.23)
aminopeptidase S (3.4.11.24)
beta-peptidyl aminopeptidase (3.4.11.25)
intermediate cleaving peptidase 55 (3.4.11.26)
glycyl-glycine dipeptidase (3.4.13.1)
glycyl-leucine dipeptidase (3.4.13.2)
Xaa-His dipeptidase (3.4.13.3)
Xaa-Arg dipeptidase (3.4.13.4)
Xaa-methyl-His dipeptidase (3.4.13.5)
Cys-Gly dipeptidase (3.4.13.6)
Glu-Glu dipeptidase (3.4.13.7)
Pro-X dipeptidase (3.4.13.8)
Xaa-Pro dipeptidase (3.4.13.9)
beta-aspartyldipeptidase (3.4.13.10)
dipeptidase (3.4.13.11)
Met-Xaa dipeptidase (3.4.13.12)
homocarnosinase (3.4.13.13)
gamma-glutamyldipeptidase (3.4.13.14)
N2-beta-alanylarginine dipeptidase (3.4.13.15)
aspartylphenylalanine dipeptidase (3.4.13.16)
non-stereospecific dipeptidase (3.4.13.17)
cytosol nonspecific dipeptidase (3.4.13.18)
membrane dipeptidase (3.4.13.19)
beta-Ala-His dipeptidase (3.4.13.20)
dipeptidase E (3.4.13.21)
D-Ala-D-Ala dipeptidase (3.4.13.22)
cysteinylglycine-S-conjugate dipeptidase (3.4.13.23)
dipeptidyl-peptidase I (3.4.14.1)
dipeptidyl-peptidase II (3.4.14.2)
acylamino-acid-releasing enzyme (3.4.14.3)
dipeptidyl-peptidase III (3.4.14.4)
dipeptidyl-peptidase IV (3.4.14.5)
dipeptidyl-dipeptidase (3.4.14.6)
tetralysine endopeptidase (3.4.14.7)
tripeptidyl peptidase (3.4.14.8)
tripeptidyl-peptidase I (3.4.14.9)
tripeptidyl-peptidase II (3.4.14.10)
Xaa-Pro dipeptidyl-peptidase (3.4.14.11)
Xaa-Xaa-Pro tripeptidyl-peptidase (3.4.14.12)
gamma-D-glutamyl-L-lysine dipeptidyl-peptidase (3.4.14.13)
[mycofactocin precursor peptide] peptidase (3.4.14.14)
peptidyl-dipeptidase A (3.4.15.1)
pepdidyl carboxyamidase (3.4.15.2)
dipeptidyl carboxypeptidase (3.4.15.3)
Peptidyl-dipeptidase B (3.4.15.4)
Peptidyl-dipeptidase Dcp (3.4.15.5)
cyanophycinase (3.4.15.6)
serine carboxypeptidase (3.4.16.1)
lysosomal Pro-Xaa carboxypeptidase (3.4.16.2)
tyrosine carboxypeptidase (3.4.16.3)
serine-type D-Ala-D-Ala carboxypeptidase (3.4.16.4)
carboxypeptidase C (3.4.16.5)
carboxypeptidase D (3.4.16.6)
carboxypeptidase A (3.4.17.1)
Sulfolobus solfataricus carboxypeptidase (3.4.17.B1)
carboxypeptidase B (3.4.17.2)
lysine carboxypeptidase (3.4.17.3)
Gly-Xaa carboxypeptidase (3.4.17.4)
Thermococcus onnurineus carboxypeptidase (3.4.17.B4)
aspartate carboxypeptidase (3.4.17.5)
Pyrococcus furiosus carboxypeptidase (3.4.17.B5)
alanine carboxypeptidase (3.4.17.6)
acylmuramoyl-alanine carboxypeptidase (3.4.17.7)
muramoylpentapeptide carboxypeptidase (3.4.17.8)
carboxypeptidase S (3.4.17.9)
carboxypeptidase E (3.4.17.10)
glutamate carboxypeptidase (3.4.17.11)
carboxypeptidase M (3.4.17.12)
Muramoyltetrapeptide carboxypeptidase (3.4.17.13)
Zinc D-Ala-D-Ala carboxypeptidase (3.4.17.14)
carboxypeptidase A2 (3.4.17.15)
membrane Pro-Xaa carboxypeptidase (3.4.17.16)
tubulinyl-Tyr carboxypeptidase (3.4.17.17)
carboxypeptidase T (3.4.17.18)
Carboxypeptidase Taq (3.4.17.19)
Carboxypeptidase U (3.4.17.20)
Glutamate carboxypeptidase II (3.4.17.21)
metallocarboxypeptidase D (3.4.17.22)
angiotensin-converting enzyme 2 (3.4.17.23)
tubulin-glutamate carboxypeptidase (3.4.17.24)
glutathione-S-conjugate glycine hydrolase (3.4.17.25)
cathepsin X (3.4.18.1)
acylaminoacyl-peptidase (3.4.19.1)
peptidyl-glycinamidase (3.4.19.2)
pyroglutamyl-peptidase I (3.4.19.3)
N-acetylmethionylpeptide peptidase (3.4.19.4)
beta-aspartyl-peptidase (3.4.19.5)
pyroglutamyl-peptidase II (3.4.19.6)
N-Formylmethionyl-peptidase (3.4.19.7)
recommended Name never specified (3.4.19.8)
folate gamma-glutamyl hydrolase (3.4.19.9)
acylmuramoyl-Ala peptidase (3.4.19.10)
gamma-D-glutamyl-meso-diaminopimelate peptidase (3.4.19.11)
ubiquitinyl hydrolase 1 (3.4.19.12)
glutathione gamma-glutamate hydrolase (3.4.19.13)
leukotriene-C4 hydrolase (3.4.19.14)
desampylase (3.4.19.15)
glucosinolate gamma-glutamyl hydrolase (3.4.19.16)
chymotrypsin (3.4.21.1)
hyaluronan-binding serine protease (3.4.21.B1)
chymotrypsin C (3.4.21.2)
granzyme M (3.4.21.B2)
duodenase (3.4.21.B3)
metridin (3.4.21.3)
granzyme K (3.4.21.B4)
trypsin (3.4.21.4)
mast cell protease 5 (3.4.21.B5)
thrombin (3.4.21.5)
coagulation factor Xa (3.4.21.6)
prostasin (3.4.21.B6)
mannan-binding lectin-associated serine protease 1 (3.4.21.B7)
plasmin (3.4.21.7)
kallikrein (3.4.21.8)
enteropeptidase (3.4.21.9)
acrosin (3.4.21.10)
neurosin (3.4.21.B10)
elastase (3.4.21.11)
alpha-lytic endopeptidase (3.4.21.12)
prostase (3.4.21.B12)
phaseolus proteinase (3.4.21.13)
microbial serine proteases (3.4.21.14)
Aspergillus alkaline proteinase (3.4.21.15)
Alternaria serine proteinase (3.4.21.16)
Arthrobacter serine proteinase (3.4.21.17)
Tenebrio alpha-proteinase (3.4.21.18)
glutamyl endopeptidase (3.4.21.19)
cathepsin G (3.4.21.20)
coagulation factor VIIa (3.4.21.21)
trepolisin (3.4.21.B21)
coagulation factor IXa (3.4.21.22)
Vipera russelli proteinase (3.4.21.23)
proprotein convertase 4 (3.4.21.B24)
red cell neutral endopeptidase (3.4.21.24)
cucumisin (3.4.21.25)
PACE4 proprotein convertase (3.4.21.B25)
prolyl oligopeptidase (3.4.21.26)
proprotein convertase 5 (3.4.21.B26)
coagulation factor XIa (3.4.21.27)
proprotein convertase 7 (3.4.21.B27)
Agkistrodon serine proteinase (3.4.21.28)
fibroblast activation protein alpha subunit (3.4.21.B28)
Bothrops atrox serine proteinase (3.4.21.29)
Crotalus adamanteus serine proteinase (3.4.21.30)
UmuD protein (3.4.21.B30)
urokinase (3.4.21.31)
brachyurin (3.4.21.32)
Entomophthora collagenolytic proteinase (3.4.21.33)
plasma kallikrein (3.4.21.34)
tricorn core protease (archaea) (3.4.21.B34)
tissue kallikrein (3.4.21.35)
pancreatic elastase (3.4.21.36)
leukocyte elastase (3.4.21.37)
coagulation factor XIIa (3.4.21.38)
chymase (3.4.21.39)
stratum corneum tryptic enzyme (3.4.21.B39)
kallikrein 9 (3.4.21.B40)
submandibular proteinase A (3.4.21.40)
complement subcomponent C1r (3.4.21.41)
kallikrein 10 (3.4.21.B41)
complement subcomponent C1s (3.4.21.42)
hippostasin (3.4.21.B42)
classical-complement-pathway C3/C5 convertase (3.4.21.43)
kallikrein 12 (3.4.21.B43)
complement component C5 convertase (3.4.21.44)
complement factor I (3.4.21.45)
kallikrein 14 (3.4.21.B45)
complement factor D (3.4.21.46)
alternative-complement-pathway C3/C5 convertase (3.4.21.47)
cerevisin (3.4.21.48)
kumamolysin (3.4.21.B48)
ctpB peptidase (3.4.21.B49)
hypodermin C (3.4.21.49)
DegQ peptidase (3.4.21.B50)
lysyl endopeptidase (3.4.21.50)
leukocyte-membrane neutral endopeptidase (3.4.21.51)
cathepsin R (3.4.21.52)
thermostable serine endopeptidase (Sulfolobus) (3.4.21.B52)
Endopeptidase La (3.4.21.53)
gamma-Renin (3.4.21.54)
Pyrococcus abyssi serine endopeptidase (3.4.21.B54)
pyrolysin (3.4.21.B55)
Venombin AB (3.4.21.55)
euphorbain (3.4.21.56)
Pyrococcus horikoshii membrane protease PH1510 (3.4.21.B56)
Leucyl endopeptidase (3.4.21.57)
pernisine (3.4.21.B57)
pernilase (3.4.21.B58)
prohormone serine proteinase (3.4.21.58)
granzyme H (3.4.21.B59)
Tryptase (3.4.21.59)
Scutelarin (3.4.21.60)
transmembrane protease serine 2 (3.4.21.B60)
Kexin (3.4.21.61)
transmembrane protease serine 11D (3.4.21.B61)
Subtilisin (3.4.21.62)
Oryzin (3.4.21.63)
peptidase K (3.4.21.64)
Thermomycolin (3.4.21.65)
Thermitase (3.4.21.66)
Endopeptidase So (3.4.21.67)
t-Plasminogen activator (3.4.21.68)
Protein C (activated) (3.4.21.69)
Pancreatic endopeptidase E (3.4.21.70)
Pancreatic elastase II (3.4.21.71)
IgA-specific serine endopeptidase (3.4.21.72)
u-Plasminogen activator (3.4.21.73)
venombin A (3.4.21.74)
Furin (3.4.21.75)
Myeloblastin (3.4.21.76)
semenogelase (3.4.21.77)
granzyme A (3.4.21.78)
granzyme B (3.4.21.79)
Streptogrisin A (3.4.21.80)
Streptogrisin B (3.4.21.81)
Glutamyl endopeptidase II (3.4.21.82)
Oligopeptidase B (3.4.21.83)
limulus clotting factor C (3.4.21.84)
limulus clotting factor B (3.4.21.85)
Limulus clotting enzyme (3.4.21.86)
omptin (3.4.21.87)
Repressor LexA (3.4.21.88)
Signal peptidase I (3.4.21.89)
Togavirin (3.4.21.90)
Flavivirin (3.4.21.91)
Endopeptidase Clp (3.4.21.92)
Proprotein convertase 1 (3.4.21.93)
proprotein convertase 2 (3.4.21.94)
Snake venom factor V activator (3.4.21.95)
Lactocepin (3.4.21.96)
assemblin (3.4.21.97)
hepacivirin (3.4.21.98)
spermosin (3.4.21.99)
sedolisin (3.4.21.100)
xanthomonalisin (3.4.21.101)
C-terminal processing peptidase (3.4.21.102)
physarolisin (3.4.21.103)
mannan-binding lectin-associated serine protease-2 (3.4.21.104)
rhomboid protease (3.4.21.105)
hepsin (3.4.21.106)
peptidase Do (3.4.21.107)
HtrA2 peptidase (3.4.21.108)
matriptase (3.4.21.109)
C5a peptidase (3.4.21.110)
aqualysin 1 (3.4.21.111)
site-1 protease (3.4.21.112)
pestivirus NS3 polyprotein peptidase (3.4.21.113)
equine arterivirus serine peptidase (3.4.21.114)
infectious pancreatic necrosis birnavirus Vp4 peptidase (3.4.21.115)
SpoIVB peptidase (3.4.21.116)
stratum corneum chymotryptic enzyme (3.4.21.117)
kallikrein 8 (3.4.21.118)
kallikrein 13 (3.4.21.119)
oviductin (3.4.21.120)
Lys-Lys/Arg-Xaa endopeptidase (3.4.21.121)
transmembrane protease serine 2 (3.4.21.122)
cathepsin B (3.4.22.1)
vignain (3.4.22.B1)
papain (3.4.22.2)
ficain (3.4.22.3)
bromelain (stem) (3.4.22.4)
bromelain (juice) (3.4.22.5)
CPB protease (3.4.22.B5)
cathepsin B-like protease (3.4.22.B6)
chymopapain (3.4.22.6)
asclepain (3.4.22.7)
clostripain (3.4.22.8)
Tpr proteinase (Porphyromonas gingivalis) (3.4.22.B8)
yeast proteinase B (3.4.22.9)
streptopain (3.4.22.10)
insulinase (3.4.22.11)
gamma-glutamyl hydrolase (3.4.22.12)
staphylococcal cysteine proteinase (3.4.22.13)
actinidain (3.4.22.14)
papain-like proteinase 1 (3.4.22.B14)
cathepsin L (3.4.22.15)
rabbit hemorrhagic disease virus 3C-like protease (3.4.22.B15)
cathepsin H (3.4.22.16)
calpain (3.4.22.17)
prolyl endopeptidase (thiol-dependent) (3.4.22.18)
endo-oligopeptidase (3.4.22.19)
YopJ protease (3.4.22.B19)
dinorphin-converting enzyme (3.4.22.20)
PfpI endopeptidase (3.4.22.B20)
yeast cysteine proteinase E (3.4.22.21)
yeast cysteine proteinase D (3.4.22.22)
yeast cysteine proteinase F (3.4.22.23)
calpain 4 (3.4.22.B24)
cathepsin T (3.4.22.24)
calpain 5 (3.4.22.B25)
glycyl endopeptidase (3.4.22.25)
calpain 6 (3.4.22.B26)
cancer procoagulant (3.4.22.26)
calpain 7 (3.4.22.B27)
cathepsin S (3.4.22.27)
calpain 8 (3.4.22.B28)
picornain 3C (3.4.22.28)
calpain 9 (3.4.22.B29)
picornain 2A (3.4.22.29)
calpain 10 (3.4.22.B30)
Caricain (3.4.22.30)
Ananain (3.4.22.31)
calpain 11 (3.4.22.B31)
calpain 12 (3.4.22.B32)
Stem bromelain (3.4.22.32)
Fruit bromelain (3.4.22.33)
Legumain (3.4.22.34)
calpain 15 (3.4.22.B35)
Histolysain (3.4.22.35)
calpain A (3.4.22.B36)
caspase-1 (3.4.22.36)
calpain B (3.4.22.B37)
gingipain R (3.4.22.37)
calpain C (3.4.22.B38)
cathepsin K (3.4.22.38)
adenain (3.4.22.39)
bleomycin hydrolase (3.4.22.40)
cathepsin F (3.4.22.41)
cathepsin O (3.4.22.42)
cathepsin V (3.4.22.43)
nuclear-inclusion-a endopeptidase (3.4.22.44)
helper-component proteinase (3.4.22.45)
L-peptidase (3.4.22.46)
gingipain K (3.4.22.47)
legume cysteine endopeptidase (3.4.22.B47)
staphopain (3.4.22.48)
cathepsin L1 (3.4.22.B49)
separase (3.4.22.49)
papain-like proteinase 2 (3.4.22.B50)
V-cath endopeptidase (3.4.22.50)
cruzipain (3.4.22.51)
calpain-1 (3.4.22.52)
calpain-2 (3.4.22.53)
calpain-3 (3.4.22.54)
caspase-2 (3.4.22.55)
caspase-3 (3.4.22.56)
caspase-4 (3.4.22.57)
caspase-5 (3.4.22.58)
caspase-6 (3.4.22.59)
caspase-7 (3.4.22.60)
cathepsin L2 (3.4.22.B60)
caspase-8 (3.4.22.61)
cathepsin L5 (3.4.22.B61)
caspase-9 (3.4.22.62)
cathepsin L3 (3.4.22.B62)
caspase-10 (3.4.22.63)
sortase C (3.4.22.B63)
caspase-11 (3.4.22.64)
sortase D (3.4.22.B64)
cathepsin P (3.4.22.B65)
peptidase 1 (mite) (3.4.22.65)
calicivirin (3.4.22.66)
caspase-12 (3.4.22.B66)
Ulp2 peptidase (3.4.22.B67)
zingipain (3.4.22.67)
EhCP4 proteinase (3.4.22.B68)
Ulp1 peptidase (3.4.22.68)
falcipain-2 (3.4.22.B69)
SARS coronavirus main proteinase (3.4.22.69)
SENP1 peptidase (3.4.22.B70)
sortase A (3.4.22.70)
SENP2 peptidase (3.4.22.B71)
sortase B (3.4.22.71)
SENP3 peptidase (3.4.22.B72)
SENP5 peptidase (3.4.22.B73)
SENP6 peptidase (3.4.22.B74)
SENP7 peptidase (3.4.22.B75)
Allium alpha-fibrinogenase AFTEII (3.4.22.B76)
Sulfolobus solfataricus peptidase (3.4.22.B77)
endopepidase PH1704 (3.4.22.B78)
nsP2 protease (3.4.22.B79)
SARS-CoV papain-like protease (3.4.22.B80)
napsin (3.4.23.B1)
pepsin A (3.4.23.1)
pepsin B (3.4.23.2)
Simian immunodeficiency virus proteinase (3.4.23.B2)
equine infectious anemia virus proteinase (3.4.23.B3)
gastricsin (3.4.23.3)
chymosin (3.4.23.4)
Feline immunodeficiency virus protease (3.4.23.B4)
cathepsin D (3.4.23.5)
murine leukemia virus protease (3.4.23.B5)
Mason-Pfizer monkey virus proteinase (3.4.23.B6)
microbial carboxyl proteinases (3.4.23.6)
Penicillium janthinellum acid proteinase (3.4.23.7)
human T-cell leukemia virus type 1 protease (3.4.23.B8)
yeast proteinase A (3.4.23.8)
bovine leukemia virus protease (3.4.23.B9)
rhizopus acid proteinase (3.4.23.9)
endothia acid proteinase (3.4.23.10)
Rous sarcoma virus retropepsin (3.4.23.B10)
spumapepsin (3.4.23.B11)
thyroid aspartic proteinase (3.4.23.11)
nepenthesin (3.4.23.12)
Lotus aspartic proteinase (3.4.23.13)
proteinase P15 (3.4.23.B13)
plasmepsin IV (3.4.23.B14)
sorghum aspartic proteinase (3.4.23.14)
renin (3.4.23.15)
HIV-1 retropepsin (3.4.23.16)
Pro-opiomelanocortin converting enzyme (3.4.23.17)
walleye dermal sarcoma virus proteinase (3.4.23.B17)
Aspergillopepsin I (3.4.23.18)
mouse mammary tumor virus retropepsin (3.4.23.B18)
Aspergillopepsin II (3.4.23.19)
plasmepsin V (3.4.23.B19)
HycD peptidase (3.4.23.B20)
Penicillopepsin (3.4.23.20)
Rhizopuspepsin (3.4.23.21)
Endothiapepsin (3.4.23.22)
Mucorpepsin (3.4.23.23)
Candidapepsin (3.4.23.24)
signal peptide peptidase (3.4.23.B24)
saccharopepsin (3.4.23.25)
thermopsin-like protease SSO1175 (3.4.23.B25)
Rhodotorulapepsin (3.4.23.26)
physaropepsin (3.4.23.27)
Acrocylindropepsin (3.4.23.28)
Polyporopepsin (3.4.23.29)
Pycnoporopepsin (3.4.23.30)
Scytalidopepsin A (3.4.23.31)
Scytalidopepsin B (3.4.23.32)
xanthomonapepsin (3.4.23.33)
cathepsin E (3.4.23.34)
Barrierpepsin (3.4.23.35)
Signal peptidase II (3.4.23.36)
pseudomonapepsin (3.4.23.37)
plasmepsin I (3.4.23.38)
plasmepsin II (3.4.23.39)
Phytepsin (3.4.23.40)
yapsin 1 (3.4.23.41)
thermopsin (3.4.23.42)
prepilin peptidase (3.4.23.43)
nodavirus endopeptidase (3.4.23.44)
memapsin 1 (3.4.23.45)
memapsin 2 (3.4.23.46)
HIV-2 retropepsin (3.4.23.47)
plasminogen activator Pla (3.4.23.48)
omptin (3.4.23.49)
human endogenous retrovirus K endopeptidase (3.4.23.50)
HycI peptidase (3.4.23.51)
preflagellin peptidase (3.4.23.52)
atrolysin A (3.4.24.1)
oligoendopeptidase F (3.4.24.B2)
Sepia proteinase (3.4.24.2)
matrix metalloproteinase-11 (3.4.24.B3)
microbial collagenase (3.4.24.3)
matrix metalloproteinase-13 (3.4.24.B4)
microbial metalloproteinases (3.4.24.4)
lens neutral proteinase (3.4.24.5)
matrix metalloproteinase-15 (3.4.24.B5)
leucolysin (3.4.24.6)
matrix metalloproteinase-20 (3.4.24.B6)
interstitial collagenase (3.4.24.7)
matrix metalloproteinase-26 (3.4.24.B7)
Achromobacter iophagus collagenase (3.4.24.8)
ADAM1 endopeptidase (3.4.24.B8)
ADAM9 endopeptidase (3.4.24.B9)
Trichophyton schoenleinii collagenase (3.4.24.9)
ADAM12 endopeptidase (3.4.24.B10)
Trichophyton mentagrophytes keratinase (3.4.24.10)
ADAMTS1 endopeptidase (3.4.24.B11)
neprilysin (3.4.24.11)
ADAMTS5 endopeptidase (3.4.24.B12)
envelysin (3.4.24.12)
IgA-specific metalloendopeptidase (3.4.24.13)
neprilysin-2 (3.4.24.B14)
procollagen N-endopeptidase (3.4.24.14)
PHEX peptidase (3.4.24.B15)
thimet oligopeptidase (3.4.24.15)
neurolysin (3.4.24.16)
protease lasA (3.4.24.B16)
FtsH endopeptidase (3.4.24.B17)
stromelysin 1 (3.4.24.17)
m-AAA protease (3.4.24.B18)
meprin A (3.4.24.18)
i-AAA protease (3.4.24.B19)
procollagen C-endopeptidase (3.4.24.19)
FtsH protease (3.4.24.B20)
peptidyl-Lys metalloendopeptidase (3.4.24.20)
astacin (3.4.24.21)
stromelysin 2 (3.4.24.22)
matrilysin (3.4.24.23)
stage IV sporulation protein FB (3.4.24.B23)
gelatinase A (3.4.24.24)
L-alanine-D-glutamate endopeptidase (3.4.24.B24)
MAHCE (3.4.24.B25)
vibriolysin (3.4.24.25)
myroilysin (3.4.24.B26)
pseudolysin (3.4.24.26)
ADAM19 (3.4.24.B27)
thermolysin (3.4.24.27)
ADAM15 (3.4.24.B28)
bacillolysin (3.4.24.28)
aureolysin (3.4.24.29)
Sulfolobus solfataricus metalloendopeptidase (3.4.24.B29)
aeropyrolysin (3.4.24.B30)
coccolysin (3.4.24.30)
mycolysin (3.4.24.31)
beta-Lytic metalloendopeptidase (3.4.24.32)
peptidyl-Asp metalloendopeptidase (3.4.24.33)
Vipera ammodytes ammodytes metalloproteinase VaH3 (3.4.24.B33)
neutrophil collagenase (3.4.24.34)
Vipera ammodytes ammodytes metalloproteinase VaF1 (3.4.24.B34)
gelatinase B (3.4.24.35)
Vipera ammodytes ammodytes metalloproteinase VaH4 (3.4.24.B35)
leishmanolysin (3.4.24.36)
Vipera ammodytes ammodytes metalloproteinase VaH1 (3.4.24.B36)
mutalysin II (3.4.24.B37)
saccharolysin (3.4.24.37)
ammodytagin (3.4.24.B38)
gametolysin (3.4.24.38)
deuterolysin (3.4.24.39)
metallo-alpha-fibrinogenase (3.4.24.B39)
ADAM 13 enpopeptidase (3.4.24.B40)
serralysin (3.4.24.40)
atrolysin B (3.4.24.41)
atrolysin C (3.4.24.42)
atroxase (3.4.24.43)
atrolysin E (3.4.24.44)
atrolysin F (3.4.24.45)
adamalysin (3.4.24.46)
horrilysin (3.4.24.47)
ruberlysin (3.4.24.48)
bothropasin (3.4.24.49)
bothrolysin (3.4.24.50)
ophiolysin (3.4.24.51)
trimerelysin I (3.4.24.52)
trimerelysin II (3.4.24.53)
mucrolysin (3.4.24.54)
pitrilysin (3.4.24.55)
insulysin (3.4.24.56)
O-sialoglycoprotein endopeptidase (3.4.24.57)
russellysin (3.4.24.58)
mitochondrial intermediate peptidase (3.4.24.59)
dactylysin (3.4.24.60)
nardilysin (3.4.24.61)
magnolysin (3.4.24.62)
meprin B (3.4.24.63)
mitochondrial processing peptidase (3.4.24.64)
macrophage elastase (3.4.24.65)
choriolysin L (3.4.24.66)
choriolysin H (3.4.24.67)
tentoxilysin (3.4.24.68)
bontoxilysin (3.4.24.69)
oligopeptidase A (3.4.24.70)
endothelin-converting enzyme 1 (3.4.24.71)
fibrolase (3.4.24.72)
jararhagin (3.4.24.73)
fragilysin (3.4.24.74)
lysostaphin (3.4.24.75)
flavastacin (3.4.24.76)
snapalysin (3.4.24.77)
gpr endopeptidase (3.4.24.78)
pappalysin-1 (3.4.24.79)
membrane-type matrix metalloproteinase-1 (3.4.24.80)
ADAM10 endopeptidase (3.4.24.81)
ADAMTS-4 endopeptidase (3.4.24.82)
anthrax lethal factor endopeptidase (3.4.24.83)
Ste24 endopeptidase (3.4.24.84)
S2P endopeptidase (3.4.24.85)
ADAM 17 endopeptidase (3.4.24.86)
ADAMTS13 endopeptidase (3.4.24.87)
desampylase (3.4.24.88)
Pro-Pro endopeptidase (3.4.24.89)
proteasome endopeptidase complex (3.4.25.1)
HslU-HslV peptidase (3.4.25.2)
acrocylindricum proteinase (3.4.99.1)
RCE1 (3.4.99.B1)
agavain (3.4.99.2)
D-aspartyl endopeptidase (3.4.99.B2)
angiotensinase (3.4.99.3)
aspartylendopeptidase (3.4.99.4)
Clostridium histolyticum collagenase 2 (3.4.99.5)
crayfish low-molecular-weight proteinase (3.4.99.6)
euphorbain (3.4.99.7)
Gliocladium proteinase (3.4.99.8)
hurain (3.4.99.9)
insulinase (3.4.99.10)
Streptomyces alkalophilic keratinase (3.4.99.11)
Trichophyton mentagrophytes keratinase (3.4.99.12)
beta-lytic proteinase (Mycobacterium sorangium) (3.4.99.13)
mexicanain (3.4.99.14)
Paecilomyces proteinase (3.4.99.15)
Penicillium notatum extracellular proteinase (3.4.99.16)
peptidoglycan endopeptidase (3.4.99.17)
pinguinain (3.4.99.18)
renin (3.4.99.19)
scopulariopsis proteinase (3.4.99.20)
solanain (3.4.99.21)
staphylokinase (3.4.99.22)
tabernamontanain (3.4.99.23)
Tenebrio alpha-proteinase (3.4.99.24)
trametes acid proteinase (3.4.99.25)
urokinase (3.4.99.26)
Echis carinatus prothrombin-activating proteinase (3.4.99.27)
Oxyuranus scutellatus prothrombin-activating proteinase (3.4.99.28)
Myxobacter AL-1 proteinase I (3.4.99.29)
Myxobacter AL-1 proteinase II (3.4.99.30)
Tissue endopeptidase degrading collagenase synthetic substrate (3.4.99.31)
Armillaria mellea neutral proteinase (3.4.99.32)
cathepsin R (3.4.99.33)
mytilidase (3.4.99.34)
premurein-leader peptidase (3.4.99.35)
leader peptidase (3.4.99.36)
RecA peptidase (3.4.99.37)
pro-opiomelanotropin-converting proteinase (3.4.99.38)
pseudomurein endopeptidase (3.4.99.39)
pro-gonadoliberin proteinase (3.4.99.40)
mitochondrial processing peptidase (3.4.99.41)
leucyllysine endopeptidase (3.4.99.42)
thermopsin (3.4.99.43)
pitrilysin (3.4.99.44)
insulinase (3.4.99.45)
multicatalytic endopeptidase complex (3.4.99.46)
asparaginase (3.5.1.1)
glutaminase (3.5.1.2)
omega-amidase (3.5.1.3)
acetylcitrulline deacetylase (3.5.1.B4)
amidase (3.5.1.4)
urease (3.5.1.5)
beta-ureidopropionase (3.5.1.6)
ureidosuccinase (3.5.1.7)
formylaspartate deformylase (3.5.1.8)
arylformamidase (3.5.1.9)
formyltetrahydrofolate deformylase (3.5.1.10)
penicillin amidase (3.5.1.11)
biotinidase (3.5.1.12)
4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase (3.5.1.B13)
aryl-acylamidase (3.5.1.13)
N-acyl-aliphatic-L-amino acid amidohydrolase (3.5.1.14)
aspartoacylase (3.5.1.15)
pyrazinamidase (3.5.1.B15)
acetylornithine deacetylase (3.5.1.16)
acyl-lysine deacylase (3.5.1.17)
4-aminobenzoylglutamate hydrolase (3.5.1.B18)
succinyl-diaminopimelate desuccinylase (3.5.1.18)
nicotinamidase (3.5.1.19)
citrullinase (3.5.1.20)
N-acetyl-beta-alanine deacetylase (3.5.1.21)
pantothenase (3.5.1.22)
ceramidase (3.5.1.23)
choloylglycine hydrolase (3.5.1.24)
N-acetylglucosamine-6-phosphate deacetylase (3.5.1.25)
N4-(beta-N-acetylglucosaminyl)-L-asparaginase (3.5.1.26)
N-formylmethionylaminoacyl-tRNA deformylase (3.5.1.27)
N-acetylmuramoyl-L-alanine amidase (3.5.1.28)
2-(acetamidomethylene)succinate hydrolase (3.5.1.29)
5-aminopentanamidase (3.5.1.30)
formylmethionine deformylase (3.5.1.31)
hippurate hydrolase (3.5.1.32)
N-acetylglucosamine deacetylase (3.5.1.33)
acetylhistidine deacetylase (3.5.1.34)
D-glutaminase (3.5.1.35)
N-methyl-2-oxoglutaramate hydrolase (3.5.1.36)
4-L-aspartylglycosylamine amidohydrolase (3.5.1.37)
glutamin-(asparagin-)ase (3.5.1.38)
alkylamidase (3.5.1.39)
acylagmatine amidase (3.5.1.40)
chitin deacetylase (3.5.1.41)
nicotinamide-nucleotide amidase (3.5.1.42)
peptidyl-glutaminase (3.5.1.43)
protein-glutamine glutaminase (3.5.1.44)
urease (ATP-hydrolysing) (3.5.1.45)
6-aminohexanoate-oligomer exohydrolase (3.5.1.46)
N-acetyldiaminopimelate deacetylase (3.5.1.47)
acetylspermidine deacetylase (3.5.1.48)
formamidase (3.5.1.49)
pentanamidase (3.5.1.50)
4-acetamidobutyryl-CoA deacetylase (3.5.1.51)
peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase (3.5.1.52)
N-carbamoylputrescine amidase (3.5.1.53)
allophanate hydrolase (3.5.1.54)
long-chain-fatty-acyl-glutamate deacylase (3.5.1.55)
N,N-dimethylformamidase (3.5.1.56)
tryptophanamidase (3.5.1.57)
N-benzyloxycarbonylglycine hydrolase (3.5.1.58)
N-carbamoylsarcosine amidase (3.5.1.59)
N-(long-chain-acyl)ethanolamine deacylase (3.5.1.60)
mimosinase (3.5.1.61)
acetylputrescine deacetylase (3.5.1.62)
4-acetamidobutyrate deacetylase (3.5.1.63)
Nalpha-benzyloxycarbonylleucine hydrolase (3.5.1.64)
theanine hydrolase (3.5.1.65)
2-(hydroxymethyl)-3-(acetamidomethylene)succinate hydrolase (3.5.1.66)
4-methyleneglutaminase (3.5.1.67)
N-formylglutamate deformylase (3.5.1.68)
glycosphingolipid deacylase (3.5.1.69)
aculeacin-A deacylase (3.5.1.70)
N-feruloylglycine deacylase (3.5.1.71)
D-benzoylarginine-4-nitroanilide amidase (3.5.1.72)
carnitinamidase (3.5.1.73)
chenodeoxycholoyltaurine hydrolase (3.5.1.74)
urethanase (3.5.1.75)
Arylalkyl acylamidase (3.5.1.76)
N-carbamoyl-D-amino-acid hydrolase (3.5.1.77)
Glutathionylspermidine amidase (3.5.1.78)
Phthalyl amidase (3.5.1.79)
N-acetylgalactosamine-6-phosphate deacetylase (3.5.1.80)
N-Acyl-D-amino-acid deacylase (3.5.1.81)
N-acyl-D-glutamate deacylase (3.5.1.82)
N-Acyl-D-aspartate deacylase (3.5.1.83)
biuret amidohydrolase (3.5.1.84)
(S)-N-acetyl-1-phenylethylamine hydrolase (3.5.1.85)
mandelamide amidase (3.5.1.86)
N-carbamoyl-L-amino-acid hydrolase (3.5.1.87)
peptide deformylase (3.5.1.88)
N-acetylglucosaminylphosphatidylinositol deacetylase (3.5.1.89)
adenosylcobinamide hydrolase (3.5.1.90)
N-substituted formamide deformylase (3.5.1.91)
pantetheine hydrolase (3.5.1.92)
glutaryl-7-aminocephalosporanic-acid acylase (3.5.1.93)
gamma-glutamyl-gamma-aminobutyrate hydrolase (3.5.1.94)
N-malonylurea hydrolase (3.5.1.95)
succinylglutamate desuccinylase (3.5.1.96)
acyl-homoserine-lactone acylase (3.5.1.97)
histone deacetylase (3.5.1.98)
fatty acid amide hydrolase (3.5.1.99)
(R)-amidase (3.5.1.100)
L-proline amide hydrolase (3.5.1.101)
2-amino-5-formylamino-6-ribosylaminopyrimidin-4(3H)-one 5'-monophosphate deformylase (3.5.1.102)
N-acetyl-1-D-myo-inositol-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (3.5.1.103)
peptidoglycan-N-acetylglucosamine deacetylase (3.5.1.104)
chitin disaccharide deacetylase (3.5.1.105)
N-formylmaleamate deformylase (3.5.1.106)
maleamate amidohydrolase (3.5.1.107)
UDP-3-O-acyl-N-acetylglucosamine deacetylase (3.5.1.108)
sphingomyelin deacylase (3.5.1.109)
ureidoacrylate amidohydrolase (3.5.1.110)
2-oxoglutaramate amidase (3.5.1.111)
2'-N-acetylparomamine deacetylase (3.5.1.112)
2'''-acetyl-6'''-hydroxyneomycin C deacetylase (3.5.1.113)
N-acyl-aromatic-L-amino acid amidohydrolase (3.5.1.114)
mycothiol S-conjugate amidase (3.5.1.115)
ureidoglycolate amidohydrolase (3.5.1.116)
6-aminohexanoate-oligomer endohydrolase (3.5.1.117)
gamma-glutamyl hercynylcysteine S-oxide hydrolase (3.5.1.118)
Pup amidohydrolase (3.5.1.119)
2-aminomuconate deaminase (2-hydroxymuconate-forming) (3.5.1.120)
protein N-terminal asparagine amidohydrolase (3.5.1.121)
protein N-terminal glutamine amidohydrolase (3.5.1.122)
gamma-glutamylanilide hydrolase (3.5.1.123)
protein deglycase (3.5.1.124)
N2-acetyl-L-2,4-diaminobutanoate deacetylase (3.5.1.125)
oxamate amidohydrolase (3.5.1.126)
jasmonoyl-L-amino acid hydrolase (3.5.1.127)
deaminated glutathione amidase (3.5.1.128)
N5-(cytidine 5'-diphosphoramidyl)-L-glutamine hydrolase (3.5.1.129)
[amino group carrier protein]-lysine hydrolase (3.5.1.130)
1-carboxybiuret hydrolase (3.5.1.131)
[amino group carrier protein]-ornithine hydrolase (3.5.1.132)
Nalpha-acyl-L-glutamine aminoacylase (3.5.1.133)
(indol-3-yl)acetyl-L-aspartate hydrolase (3.5.1.134)
N4-acetylcytidine amidohydrolase (3.5.1.135)
N,N'-diacetylchitobiose non-reducing end deacetylase (3.5.1.136)
N-methylcarbamate hydrolase (3.5.1.137)
barbiturase (3.5.2.1)
(+)-gamma-lactamase (3.5.2.B2)
dihydropyrimidinase (3.5.2.2)
(-)-gamma-lactamase (3.5.2.B3)
dihydroorotase (3.5.2.3)
carboxymethylhydantoinase (3.5.2.4)
allantoinase (3.5.2.5)
beta-lactamase (3.5.2.6)
imidazolonepropionase (3.5.2.7)
cephalosporinase (3.5.2.8)
5-oxoprolinase (ATP-hydrolysing) (3.5.2.9)
creatininase (3.5.2.10)
L-lysine-lactamase (3.5.2.11)
6-aminohexanoate-cyclic-dimer hydrolase (3.5.2.12)
2,5-dioxopiperazine hydrolase (3.5.2.13)
N-methylhydantoinase (ATP-hydrolysing) (3.5.2.14)
cyanuric acid amidohydrolase (3.5.2.15)
maleimide hydrolase (3.5.2.16)
hydroxyisourate hydrolase (3.5.2.17)
enamidase (3.5.2.18)
streptothricin hydrolase (3.5.2.19)
isatin hydrolase (3.5.2.20)
arginase (3.5.3.1)
guanidinoacetase (3.5.3.2)
creatinase (3.5.3.3)
allantoicase (3.5.3.4)
formimidoylaspartate deiminase (3.5.3.5)
arginine deiminase (3.5.3.6)
guanidinobutyrase (3.5.3.7)
formimidoylglutamase (3.5.3.8)
allantoate deiminase (3.5.3.9)
D-arginase (3.5.3.10)
agmatinase (3.5.3.11)
agmatine deiminase (3.5.3.12)
formimidoylglutamate deiminase (3.5.3.13)
amidinoaspartase (3.5.3.14)
protein-arginine deiminase (3.5.3.15)
methylguanidinase (3.5.3.16)
Guanidinopropionase (3.5.3.17)
dimethylargininase (3.5.3.18)
ureidoglycolate hydrolase (3.5.3.19)
diguanidinobutanase (3.5.3.20)
methylenediurea deaminase (3.5.3.21)
proclavaminate amidinohydrolase (3.5.3.22)
N-succinylarginine dihydrolase (3.5.3.23)
N1-aminopropylagmatine ureohydrolase (3.5.3.24)
Nomega-hydroxy-L-arginine amidinohydrolase (3.5.3.25)
(S)-ureidoglycine aminohydrolase (3.5.3.26)
cytosine deaminase (3.5.4.1)
adenine deaminase (3.5.4.2)
guanine deaminase (3.5.4.3)
adenosine deaminase (3.5.4.4)
cytidine deaminase (3.5.4.5)
AMP deaminase (3.5.4.6)
ADP deaminase (3.5.4.7)
aminoimidazolase (3.5.4.8)
cytosine deaminase APOBEC3G (3.5.4.B9)
methenyltetrahydrofolate cyclohydrolase (3.5.4.9)
IMP cyclohydrolase (3.5.4.10)
pterin deaminase (3.5.4.11)
dCMP deaminase (3.5.4.12)
dCTP deaminase (3.5.4.13)
deoxycytidine deaminase (3.5.4.14)
guanosine deaminase (3.5.4.15)
GTP cyclohydrolase I (3.5.4.16)
adenosine-phosphate deaminase (3.5.4.17)
ATP deaminase (3.5.4.18)
phosphoribosyl-AMP cyclohydrolase (3.5.4.19)
pyrithiamine deaminase (3.5.4.20)
creatinine deaminase (3.5.4.21)
1-pyrroline-4-hydroxy-2-carboxylate deaminase (3.5.4.22)
blasticidin-S deaminase (3.5.4.23)
sepiapterin deaminase (3.5.4.24)
GTP cyclohydrolase II (3.5.4.25)
diaminohydroxyphosphoribosylaminopyrimidine deaminase (3.5.4.26)
methenyltetrahydromethanopterin cyclohydrolase (3.5.4.27)
S-adenosylhomocysteine deaminase (3.5.4.28)
GTP cyclohydrolase IIa (3.5.4.29)
dCTP deaminase (dUMP-forming) (3.5.4.30)
S-methyl-5'-thioadenosine deaminase (3.5.4.31)
8-oxoguanine deaminase (3.5.4.32)
tRNA(adenine34) deaminase (3.5.4.33)
tRNAAla(adenine37) deaminase (3.5.4.34)
tRNA(cytosine8) deaminase (3.5.4.35)
mRNA(cytosine6666) deaminase (3.5.4.36)
double-stranded RNA adenine deaminase (3.5.4.37)
single-stranded DNA cytosine deaminase (3.5.4.38)
GTP cyclohydrolase IV (3.5.4.39)
aminodeoxyfutalosine deaminase (3.5.4.40)
5'-deoxyadenosine deaminase (3.5.4.41)
N-isopropylammelide isopropylaminohydrolase (3.5.4.42)
hydroxydechloroatrazine ethylaminohydrolase (3.5.4.43)
ectoine hydrolase (3.5.4.44)
melamine deaminase (3.5.4.45)
cAMP deaminase (3.5.4.46)
nitrilase (3.5.5.1)
ricinine nitrilase (3.5.5.2)
cyanate hydrolase (3.5.5.3)
cyanoalanine nitrilase (3.5.5.4)
Arylacetonitrilase (3.5.5.5)
bromoxynil nitrilase (3.5.5.6)
Aliphatic nitrilase (3.5.5.7)
thiocyanate hydrolase (3.5.5.8)
riboflavinase (3.5.99.1)
aminopyrimidine aminohydrolase (3.5.99.2)
hydroxydechloroatrazine ethylaminohydrolase (3.5.99.3)
N-isopropylammelide isopropylaminohydrolase (3.5.99.4)
2-aminomuconate deaminase (3.5.99.5)
glucosamine-6-phosphate deaminase (3.5.99.6)
1-aminocyclopropane-1-carboxylate deaminase (3.5.99.7)
5-nitroanthranilic acid aminohydrolase (3.5.99.8)
2-nitroimidazole nitrohydrolase (3.5.99.9)
2-iminobutanoate/2-iminopropanoate deaminase (3.5.99.10)
2-aminomuconate deaminase (2-hydroxymuconate-forming) (3.5.99.11)
inorganic diphosphatase (3.6.1.1)
trimetaphosphatase (3.6.1.2)
adenosinetriphosphatase (3.6.1.3)
adenosinetriphosphatase (Mg-activated) (3.6.1.4)
apyrase (3.6.1.5)
nucleoside diphosphate phosphatase (3.6.1.6)
acylphosphatase (3.6.1.7)
ATP diphosphatase (3.6.1.8)
nucleotide diphosphatase (3.6.1.9)
endopolyphosphatase (3.6.1.10)
exopolyphosphatase (3.6.1.11)
multiple site diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase (3.6.1.B11)
dCTP diphosphatase (3.6.1.12)
ADP-ribose diphosphatase (3.6.1.13)
adenosine-tetraphosphatase (3.6.1.14)
nucleoside-triphosphate phosphatase (3.6.1.15)
CDP-glycerol diphosphatase (3.6.1.16)
guanosine-3',5'-bis(diphosphate) bisphosphatase (3.6.1.B16)
ATP-independent RNA helicase (3.6.1.B17)
bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (3.6.1.17)
FAD diphosphatase (3.6.1.18)
inositol diphosphate 1-phosphatase (3.6.1.B18)
nucleoside-triphosphate diphosphatase (3.6.1.19)
5'-acylphosphoadenosine hydrolase (3.6.1.20)
ADP-sugar diphosphatase (3.6.1.21)
NAD+ diphosphatase (3.6.1.22)
dUTP diphosphatase (3.6.1.23)
nucleoside phosphoacylhydrolase (3.6.1.24)
triphosphatase (3.6.1.25)
CDP-diacylglycerol diphosphatase (3.6.1.26)
undecaprenyl-diphosphate phosphatase (3.6.1.27)
thiamine-triphosphatase (3.6.1.28)
bis(5'-adenosyl)-triphosphatase (3.6.1.29)
m7G(5')pppN diphosphatase (3.6.1.30)
phosphoribosyl-ATP diphosphatase (3.6.1.31)
myosin ATPase (3.6.1.32)
dynein ATPase (3.6.1.33)
H+-transporting ATP synthase (3.6.1.34)
H+-transporting ATPase (3.6.1.35)
H+/K+ exchanging ATPase (3.6.1.36)
Na+/K+ exchanging ATPase (3.6.1.37)
Ca2+-transporting ATPase (3.6.1.38)
thymidine-triphosphatase (3.6.1.39)
guanosine-5'-triphosphate,3'-diphosphate phosphatase (3.6.1.40)
bis(5'-nucleosyl)-tetraphosphatase (symmetrical) (3.6.1.41)
guanosine-diphosphatase (3.6.1.42)
dolichyldiphosphatase (3.6.1.43)
oligosaccharide-diphosphodolichol diphosphatase (3.6.1.44)
UDP-sugar diphosphatase (3.6.1.45)
heterotrimeric G-protein GTPase (3.6.1.46)
small monomeric GTPase (3.6.1.47)
protein-synthesizing GTPase (3.6.1.48)
signal-recognition-particle GTPase (3.6.1.49)
dynamin GTPase (3.6.1.50)
tubulin GTPase (3.6.1.51)
diphosphoinositol-polyphosphate diphosphatase (3.6.1.52)
Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase (3.6.1.53)
UDP-2,3-diacylglucosamine diphosphatase (3.6.1.54)
8-oxo-dGTP diphosphatase (3.6.1.55)
2-hydroxy-dATP diphosphatase (3.6.1.56)
UDP-2,4-diacetamido-2,4,6-trideoxy-beta-L-altropyranose hydrolase (3.6.1.57)
8-oxo-dGDP phosphatase (3.6.1.58)
5'-(N7-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase (3.6.1.59)
diadenosine hexaphosphate hydrolase (AMP-forming) (3.6.1.60)
diadenosine hexaphosphate hydrolase (ATP-forming) (3.6.1.61)
5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase (3.6.1.62)
alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase (3.6.1.63)
inosine diphosphate phosphatase (3.6.1.64)
(d)CTP diphosphatase (3.6.1.65)
XTP/dITP diphosphatase (3.6.1.66)
dihydroneopterin triphosphate diphosphatase (3.6.1.67)
geranyl diphosphate phosphohydrolase (3.6.1.68)
8-oxo-(d)GTP phosphatase (3.6.1.69)
guanosine-5'-diphospho-5'-[DNA] diphosphatase (3.6.1.70)
adenosine-5'-diphospho-5'-[DNA] diphosphatase (3.6.1.71)
DNA-3'-diphospho-5'-guanosine diphosphatase (3.6.1.72)
inosine/xanthosine triphosphatase (3.6.1.73)
mRNA 5'-phosphatase (3.6.1.74)
diacylglycerol diphosphate phosphatase (3.6.1.75)
adenylylsulfatase (3.6.2.1)
phosphoadenylylsulfatase (3.6.2.2)
phospholipid-translocating ATPase (3.6.3.1)
Mg2+-importing ATPase (3.6.3.2)
Cd2+-exporting ATPase (3.6.3.3)
Cu2+-exporting ATPase (3.6.3.4)
Zn2+-exporting ATPase (3.6.3.5)
H+-exporting ATPase (3.6.3.6)
Na+-exporting ATPase (3.6.3.7)
Ca2+-transporting ATPase (3.6.3.8)
Na+/K+-exchanging ATPase (3.6.3.9)
H+/K+-exchanging ATPase (3.6.3.10)
Cl--transporting ATPase (3.6.3.11)
K+-transporting ATPase (3.6.3.12)
aminophospholipid-transporting ATPase (3.6.3.13)
H+-transporting two-sector ATPase (3.6.3.14)
Na+-transporting two-sector ATPase (3.6.3.15)
arsenite-transporting ATPase (3.6.3.16)
monosaccharide-transporting ATPase (3.6.3.17)
oligosaccharide-transporting ATPase (3.6.3.18)
maltose-transporting ATPase (3.6.3.19)
glycerol-3-phosphate-transporting ATPase (3.6.3.20)
polar-amino-acid-transporting ATPase (3.6.3.21)
nonpolar-amino-acid-transporting ATPase (3.6.3.22)
oligopeptide-transporting ATPase (3.6.3.23)
nickel-transporting ATPase (3.6.3.24)
sulfate-transporting ATPase (3.6.3.25)
nitrate-transporting ATPase (3.6.3.26)
phosphate-transporting ATPase (3.6.3.27)
phosphonate-transporting ATPase (3.6.3.28)
molybdate-transporting ATPase (3.6.3.29)
Fe3+-transporting ATPase (3.6.3.30)
polyamine-transporting ATPase (3.6.3.31)
quaternary-amine-transporting ATPase (3.6.3.32)
vitamin B12-transporting ATPase (3.6.3.33)
iron-chelate-transporting ATPase (3.6.3.34)
manganese-transporting ATPase (3.6.3.35)
taurine-transporting ATPase (3.6.3.36)
guanine-transporting ATPase (3.6.3.37)
capsular-polysaccharide-transporting ATPase (3.6.3.38)
lipopolysaccharide-transporting ATPase (3.6.3.39)
teichoic-acid-transporting ATPase (3.6.3.40)
heme-transporting ATPase (3.6.3.41)
beta-glucan-transporting ATPase (3.6.3.42)
peptide-transporting ATPase (3.6.3.43)
xenobiotic-transporting ATPase (3.6.3.44)
steroid-transporting ATPase (3.6.3.45)
cadmium-transporting ATPase (3.6.3.46)
fatty-acyl-CoA-transporting ATPase (3.6.3.47)
alpha-factor-transporting ATPase (3.6.3.48)
channel-conductance-controlling ATPase (3.6.3.49)
protein-secreting ATPase (3.6.3.50)
mitochondrial protein-transporting ATPase (3.6.3.51)
chloroplast protein-transporting ATPase (3.6.3.52)
Ag+-exporting ATPase (3.6.3.53)
Cu+-exporting ATPase (3.6.3.54)
tungstate-importing ATPase (3.6.3.55)
kinesin K16 (3.6.4.B1)
myosin ATPase (3.6.4.1)
dynein ATPase (3.6.4.2)
microtubule-severing ATPase (3.6.4.3)
plus-end-directed kinesin ATPase (3.6.4.4)
presynaptic-filament-stabilizing ATPase (3.6.4.B4)
minus-end-directed kinesin ATPase (3.6.4.5)
archaeal flagellar ATPase (3.6.4.B6)
vesicle-fusing ATPase (3.6.4.6)
peroxisome-assembly ATPase (3.6.4.7)
RadA recombinase (3.6.4.B7)
clamp-loader complex (3.6.4.B8)
proteasome ATPase (3.6.4.8)
chaperonin ATPase (3.6.4.9)
Rad54 translocase (3.6.4.B9)
chaperonin ATPase (protein-folding, protecting from aggregation, protein stabilizing) (3.6.4.B10)
non-chaperonin molecular chaperone ATPase (3.6.4.10)
chromosome segregation protein SegA (3.6.4.B11)
nucleoplasmin ATPase (3.6.4.11)
DNA helicase (3.6.4.12)
RNA helicase (3.6.4.13)
heterotrimeric G-protein GTPase (3.6.5.1)
small monomeric GTPase (3.6.5.2)
protein-synthesizing GTPase (3.6.5.3)
signal-recognition-particle GTPase (3.6.5.4)
dynamin GTPase (3.6.5.5)
tubulin GTPase (3.6.5.6)
oxaloacetase (3.7.1.1)
fumarylacetoacetase (3.7.1.2)
kynureninase (3.7.1.3)
phloretin hydrolase (3.7.1.4)
acylpyruvate hydrolase (3.7.1.5)
acetylpyruvate hydrolase (3.7.1.6)
beta-diketone hydrolase (3.7.1.7)
2,6-dioxo-6-phenylhexa-3-enoate hydrolase (3.7.1.8)
2-hydroxymuconate-6-semialdehyde hydrolase (3.7.1.9)
cyclohexane-1,3-dione hydrolase (3.7.1.10)
cyclohexane-1,2-dione hydrolase (3.7.1.11)
cobalt-precorrin 5A hydrolase (3.7.1.12)
2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase (3.7.1.13)
2-hydroxy-6-oxonona-2,4-dienedioate hydrolase (3.7.1.14)
(+)-caryolan-1-ol synthase (3.7.1.15)
oxepin-CoA hydrolase (3.7.1.16)
4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase (3.7.1.17)
6-oxocamphor hydrolase (3.7.1.18)
2,6-dihydroxypseudooxynicotine hydrolase (3.7.1.19)
3-fumarylpyruvate hydrolase (3.7.1.20)
6-oxocyclohex-1-ene-1-carbonyl-CoA hydratase (3.7.1.21)
3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (ring-opening) (3.7.1.22)
maleylpyruvate hydrolase (3.7.1.23)
2,4-diacetylphloroglucinol hydrolase (3.7.1.24)
2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (3.7.1.25)
2,4-didehydro-3-deoxy-L-rhamnonate hydrolase (3.7.1.26)
neryl diphosphate diphosphatase (3.7.1.27)
3-oxoisoapionate-4-phosphate transcarboxylase/hydrolase (3.7.1.28)
2-haloacrylate hydratase (3.8.1.B1)
alkylhalidase (3.8.1.1)
(S)-2-haloacid dehalogenase (3.8.1.2)
haloacetate dehalogenase (3.8.1.3)
thyroxine deiodinase (3.8.1.4)
haloalkane dehalogenase (3.8.1.5)
4-chlorobenzoate dehalogenase (3.8.1.6)
4-chlorobenzoyl-CoA dehalogenase (3.8.1.7)
atrazine chlorohydrolase (3.8.1.8)
(R)-2-haloacid dehalogenase (3.8.1.9)
2-haloacid dehalogenase (configuration-inverting) (3.8.1.10)
2-haloacid dehalogenase (configuration-retaining) (3.8.1.11)
di-isopropyl-fluorophosphatase (3.8.2.1)
phosphoamidase (3.9.1.1)
protein arginine phosphatase (3.9.1.2)
phosphohistidine phosphatase (3.9.1.3)
N-sulfoglucosamine sulfohydrolase (3.10.1.1)
cyclamate sulfohydrolase (3.10.1.2)
phosphonoacetaldehyde hydrolase (3.11.1.1)
phosphonoacetate hydrolase (3.11.1.2)
phosphonopyruvate hydrolase (3.11.1.3)
tetrathionate hydrolase (3.12.1.B1)
trithionate hydrolase (3.12.1.1)
UDP-sulfoquinovose synthase (3.13.1.1)
5-deoxyribos-5-ylhomocysteinase (3.13.1.2)
2'-hydroxybiphenyl-2-sulfinate desulfinase (3.13.1.3)
3-sulfinopropanoyl-CoA desulfinase (3.13.1.4)
carbon disulfide hydrolase (3.13.1.5)
[CysO sulfur-carrier protein]-S-L-cysteine hydrolase (3.13.1.6)
carbonyl sulfide hydrolase (3.13.1.7)
S-adenosyl-L-methionine hydrolase (adenosine-forming) (3.13.1.8)
S-inosyl-L-homocysteine hydrolase (3.13.1.9)
adenosylhomocysteinase (3.13.2.1)
inosylhomocysteinase (3.13.2.B1)
S-adenosyl-L-methionine hydrolase (L-homoserine-forming) (3.13.2.2)
(R)-S-adenosyl-L-methionine hydrolase (adenosine-forming) (3.13.2.3)
pyruvate decarboxylase (4.1.1.1)
oxalate decarboxylase (4.1.1.2)
oxaloacetate decarboxylase (4.1.1.3)
acetoacetate decarboxylase (4.1.1.4)
UDP-N-acetylglucosaminuronate decarboxylase (4.1.1.B4)
acetolactate decarboxylase (4.1.1.5)
cis-aconitate decarboxylase (4.1.1.6)
benzoylformate decarboxylase (4.1.1.7)
oxalyl-CoA decarboxylase (4.1.1.8)
malonyl-CoA decarboxylase (4.1.1.9)
aminomalonate decarboxylase (4.1.1.10)
aspartate 1-decarboxylase (4.1.1.11)
aspartate 4-decarboxylase (4.1.1.12)
lysine/ornithine carboxy-lyase (4.1.1.B12)
carbamoylaspartate decarboxylase (4.1.1.13)
valine decarboxylase (4.1.1.14)
D-ornithine/D-lysine decarboxylase (4.1.1.B15)
glutamate decarboxylase (4.1.1.15)
Hydroxyglutamate decarboxylase (4.1.1.16)
ornithine decarboxylase (4.1.1.17)
lysine decarboxylase (4.1.1.18)
arginine decarboxylase (4.1.1.19)
diaminopimelate decarboxylase (4.1.1.20)
phosphoribosylaminoimidazole carboxylase (4.1.1.21)
histidine decarboxylase (4.1.1.22)
orotidine-5'-phosphate decarboxylase (4.1.1.23)
aminobenzoate decarboxylase (4.1.1.24)
tyrosine decarboxylase (4.1.1.25)
DOPA decarboxylase (4.1.1.26)
tryptophan decarboxylase (4.1.1.27)
aromatic-L-amino-acid decarboxylase (4.1.1.28)
sulfinoalanine decarboxylase (4.1.1.29)
pantothenoylcysteine decarboxylase (4.1.1.30)
phosphoenolpyruvate carboxylase (4.1.1.31)
phosphoenolpyruvate carboxykinase (GTP) (4.1.1.32)
diphosphomevalonate decarboxylase (4.1.1.33)
dehydro-L-gulonate decarboxylase (4.1.1.34)
UDP-glucuronate decarboxylase (4.1.1.35)
phosphopantothenoylcysteine decarboxylase (4.1.1.36)
uroporphyrinogen decarboxylase (4.1.1.37)
phosphoenolpyruvate carboxykinase (diphosphate) (4.1.1.38)
ribulose-bisphosphate carboxylase (4.1.1.39)
hydroxypyruvate decarboxylase (4.1.1.40)
(S)-methylmalonyl-CoA decarboxylase (4.1.1.41)
carnitine decarboxylase (4.1.1.42)
phenylpyruvate decarboxylase (4.1.1.43)
4-carboxymuconolactone decarboxylase (4.1.1.44)
aminocarboxymuconate-semialdehyde decarboxylase (4.1.1.45)
o-pyrocatechuate decarboxylase (4.1.1.46)
tartronate-semialdehyde synthase (4.1.1.47)
indole-3-glycerol-phosphate synthase (4.1.1.48)
phosphoenolpyruvate carboxykinase (ATP) (4.1.1.49)
adenosylmethionine decarboxylase (4.1.1.50)
3-hydroxy-2-methylpyridine-4,5-dicarboxylate 4-decarboxylase (4.1.1.51)
6-methylsalicylate decarboxylase (4.1.1.52)
phenylalanine decarboxylase (4.1.1.53)
dihydroxyfumarate decarboxylase (4.1.1.54)
4,5-dihydroxyphthalate decarboxylase (4.1.1.55)
3-oxolaurate decarboxylase (4.1.1.56)
methionine decarboxylase (4.1.1.57)
orsellinate decarboxylase (4.1.1.58)
gallate decarboxylase (4.1.1.59)
stipitatonate decarboxylase (4.1.1.60)
4-hydroxybenzoate decarboxylase (4.1.1.61)
gentisate decarboxylase (4.1.1.62)
protocatechuate decarboxylase (4.1.1.63)
2,2-dialkylglycine decarboxylase (pyruvate) (4.1.1.64)
phosphatidylserine decarboxylase (4.1.1.65)
uracil-5-carboxylate decarboxylase (4.1.1.66)
UDP-galacturonate decarboxylase (4.1.1.67)
5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase (4.1.1.68)
3,4-dihydroxyphthalate decarboxylase (4.1.1.69)
glutaconyl-CoA decarboxylase (4.1.1.70)
2-oxoglutarate decarboxylase (4.1.1.71)
branched-chain-2-oxoacid decarboxylase (4.1.1.72)
tartrate decarboxylase (4.1.1.73)
indolepyruvate decarboxylase (4.1.1.74)
5-guanidino-2-oxopentanoate decarboxylase (4.1.1.75)
arylmalonate decarboxylase (4.1.1.76)
2-oxo-3-hexenedioate decarboxylase (4.1.1.77)
acetylenedicarboxylate decarboxylase (4.1.1.78)
sulfopyruvate decarboxylase (4.1.1.79)
4-hydroxyphenylpyruvate decarboxylase (4.1.1.80)
threonine-phosphate decarboxylase (4.1.1.81)
phosphonopyruvate decarboxylase (4.1.1.82)
4-hydroxyphenylacetate decarboxylase (4.1.1.83)
D-dopachrome decarboxylase (4.1.1.84)
3-dehydro-L-gulonate-6-phosphate decarboxylase (4.1.1.85)
diaminobutyrate decarboxylase (4.1.1.86)
malonyl-S-ACP decarboxylase (4.1.1.87)
biotin-independent malonate decarboxylase (4.1.1.88)
biotin-dependent malonate decarboxylase (4.1.1.89)
peptidyl-glutamate 4-carboxylase (4.1.1.90)
salicylate decarboxylase (4.1.1.91)
indole-3-carboxylate decarboxylase (4.1.1.92)
pyrrole-2-carboxylate decarboxylase (4.1.1.93)
ethylmalonyl-CoA decarboxylase (4.1.1.94)
L-glutamyl-[BtrI acyl-carrier protein] decarboxylase (4.1.1.95)
carboxynorspermidine decarboxylase (4.1.1.96)
2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (4.1.1.97)
4-hydroxy-3-polyprenylbenzoate decarboxylase (4.1.1.98)
phosphomevalonate decarboxylase (4.1.1.99)
prephenate decarboxylase (4.1.1.100)
malolactic enzyme (4.1.1.101)
phenacrylate decarboxylase (4.1.1.102)
gamma-resorcylate decarboxylase (4.1.1.103)
3-dehydro-4-phosphotetronate decarboxylase (4.1.1.104)
L-tryptophan decarboxylase (4.1.1.105)
fatty acid photodecarboxylase (4.1.1.106)
3,4-dihydroxyphenylacetaldehyde synthase (4.1.1.107)
4-hydroxyphenylacetaldehyde synthase (4.1.1.108)
phenylacetaldehyde synthase (4.1.1.109)
bisphosphomevalonate decarboxylase (4.1.1.110)
siroheme decarboxylase (4.1.1.111)
oxaloacetate decarboxylase (4.1.1.112)
trans-aconitate decarboxylase (4.1.1.113)
cis-3-alkyl-4-alkyloxetan-2-one decarboxylase (4.1.1.114)
indoleacetate decarboxylase (4.1.1.115)
D-ornithine/D-lysine decarboxylase (4.1.1.116)
2-[(L-alanin-3-ylcarbamoyl)methyl]-2-hydroxybutanedioate decarboxylase (4.1.1.117)
isophthalyl-CoA decarboxylas (4.1.1.118)
phenylacetate decarboxylase (4.1.1.119)
3-oxoisoapionate decarboxylase (4.1.1.120)
3-oxoisoapionate-4-phosphate decarboxylase (4.1.1.121)
L-cysteate decarboxylase (4.1.1.122)
phenyl-phosphate phosphatase/carboxylase (4.1.1.123)
hydroxyoxobutyrate aldolase (4.1.2.1)
ketotetrose-phosphate aldolase (4.1.2.2)
pentosealdolase (4.1.2.3)
deoxyribose-phosphate aldolase (4.1.2.4)
L-threonine aldolase (4.1.2.5)
allothreonine aldolase (4.1.2.6)
aromatic (R)-hydroxynitrile lyase (4.1.2.B6)
ketose-1-phosphate aldolase (4.1.2.7)
indole-3-glycerol-phosphate lyase (4.1.2.8)
phosphoketolase (4.1.2.9)
(R)-mandelonitrile lyase (4.1.2.10)
hydroxymandelonitrile lyase (4.1.2.11)
2-dehydropantoate aldolase (4.1.2.12)
ferulate aldolase (4.1.2.B12)
fructose-bisphosphate aldolase (4.1.2.13)
2-dehydro-3-deoxy-phosphogluconate aldolase (4.1.2.14)
2-dehydro-3-deoxy-phosphoheptonate aldolase (4.1.2.15)
2-dehydro-3-deoxy-phosphooctonate aldolase (4.1.2.16)
L-fuculose-phosphate aldolase (4.1.2.17)
2-dehydro-3-deoxy-L-pentonate aldolase (4.1.2.18)
rhamnulose-1-phosphate aldolase (4.1.2.19)
2-dehydro-3-deoxyglucarate aldolase (4.1.2.20)
2-dehydro-3-deoxy-6-phosphogalactonate aldolase (4.1.2.21)
fructose-6-phosphate phosphoketolase (4.1.2.22)
3-deoxy-D-manno-octulosonate aldolase (4.1.2.23)
dimethylaniline-N-oxide aldolase (4.1.2.24)
dihydroneopterin aldolase (4.1.2.25)
phenylserine aldolase (4.1.2.26)
sphinganine-1-phosphate aldolase (4.1.2.27)
2-dehydro-3-deoxy-D-pentonate aldolase (4.1.2.28)
5-dehydro-2-deoxyphosphogluconate aldolase (4.1.2.29)
17alpha-hydroxyprogesterone aldolase (4.1.2.30)
2-oxo-4-hydroxyglutarate aldolase (4.1.2.31)
trimethylamine-oxide aldolase (4.1.2.32)
fucosterol-epoxide lyase (4.1.2.33)
4-(2-carboxyphenyl)-2-oxobut-3-enoate aldolase (4.1.2.34)
propioin synthase (4.1.2.35)
lactate aldolase (4.1.2.36)
hydroxynitrilase (4.1.2.37)
benzoin aldolase (4.1.2.38)
hydroxynitrilase (4.1.2.39)
tagatose-bisphosphate aldolase (4.1.2.40)
vanillin synthase (4.1.2.41)
D-threonine aldolase (4.1.2.42)
3-hexulose-6-phosphate synthase (4.1.2.43)
2,3-epoxybenzoyl-CoA dihydrolase (4.1.2.44)
trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (4.1.2.45)
aliphatic (R)-hydroxynitrile lyase (4.1.2.46)
(S)-hydroxynitrile lyase (4.1.2.47)
low-specificity L-threonine aldolase (4.1.2.48)
L-allo-threonine aldolase (4.1.2.49)
6-carboxytetrahydropterin synthase (4.1.2.50)
2-dehydro-3-deoxy-D-gluconate aldolase (4.1.2.51)
4-hydroxy-2-oxoheptanedioate aldolase (4.1.2.52)
2-keto-3-deoxy-L-rhamnonate aldolase (4.1.2.53)
L-threo-3-deoxy-hexylosonate aldolase (4.1.2.54)
2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase (4.1.2.55)
2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase (4.1.2.56)
sulfofructosephosphate aldolase (4.1.2.57)
2-dehydro-3,6-dideoxy-6-sulfogluconate aldolase (4.1.2.58)
dihydroneopterin phosphate aldolase (4.1.2.59)
dihydroneopterin triphosphate aldolase (4.1.2.60)
feruloyl-CoA hydratase/lyase (4.1.2.61)
5-deoxyribulose 1-phosphate aldolase (4.1.2.62)
2-hydroxyacyl-CoA lyase (4.1.2.63)
isocitrate lyase (4.1.3.1)
malate synthase (4.1.3.2)
4-carboxy-4-hydroxy-2-oxoadipate aldolase (4.1.3.B3)
N-acetylneuraminate lyase (4.1.3.3)
hydroxymethylglutaryl-CoA lyase (4.1.3.4)
hydroxymethylglutaryl-CoA synthase (4.1.3.5)
citrate (pro-3S)-lyase (4.1.3.6)
citrate (si)-synthase (4.1.3.7)
ATP citrate (pro-S)-lyase (4.1.3.8)
2-hydroxyglutarate synthase (4.1.3.9)
3-ethylmalate synthase (4.1.3.10)
3-propylmalate synthase (4.1.3.11)
2-isopropylmalate synthase (4.1.3.12)
Oxalomalate lyase (4.1.3.13)
L-erythro-3-hydroxyaspartate aldolase (4.1.3.14)
2-hydroxy-3-oxoadipate synthase (4.1.3.15)
4-Hydroxy-2-oxoglutarate aldolase (4.1.3.16)
4-hydroxy-4-methyl-2-oxoglutarate aldolase (4.1.3.17)
acetolactate synthase (4.1.3.18)
N-acetylneuraminate synthase (4.1.3.19)
N-acylneuraminate-9-phosphate synthase (4.1.3.20)
homocitrate synthase (4.1.3.21)
citramalate lyase (4.1.3.22)
decylcitrate synthase (4.1.3.23)
malyl-CoA lyase (4.1.3.24)
(S)-citramalyl-CoA lyase (4.1.3.25)
3-Hydroxy-3-isohexenylglutaryl-CoA lyase (4.1.3.26)
anthranilate synthase (4.1.3.27)
citrate (re)-synthase (4.1.3.28)
decylhomocitrate synthase (4.1.3.29)
Methylisocitrate lyase (4.1.3.30)
2-methylcitrate synthase (4.1.3.31)
2,3-Dimethylmalate lyase (4.1.3.32)
2-ethylmalate synthase (4.1.3.33)
citryl-CoA lyase (4.1.3.34)
(1-hydroxycyclohexan-1-yl)acetyl-CoA lyase (4.1.3.35)
1,4-dihydroxy-2-naphthoyl-CoA synthase (4.1.3.36)
1-deoxy-D-xylulose 5-phosphate synthase (4.1.3.37)
aminodeoxychorismate lyase (4.1.3.38)
4-hydroxy-2-oxovalerate aldolase (4.1.3.39)
chorismate lyase (4.1.3.40)
3-hydroxy-D-aspartate aldolase (4.1.3.41)
(4S)-4-hydroxy-2-oxoglutarate aldolase (4.1.3.42)
4-hydroxy-2-oxohexanoate aldolase (4.1.3.43)
tRNA 4-demethylwyosine synthase (AdoMet-dependent) (4.1.3.44)
3-hydroxybenzoate synthase (4.1.3.45)
(R)-citramalyl-CoA lyase (4.1.3.46)
tryptophanase (4.1.99.1)
tyrosine phenol-lyase (4.1.99.2)
deoxyribodipyrimidine photo-lyase (4.1.99.3)
1-aminocyclopropane-1-carboxylate deaminase (4.1.99.4)
aldehyde oxygenase (deformylating) (4.1.99.5)
trichodiene synthase (4.1.99.6)
aristolochene synthase (4.1.99.7)
pinene synthase (4.1.99.8)
myrcene synthase (4.1.99.9)
(-)-(4S )-limonene synthase (4.1.99.10)
benzylsuccinate synthase (4.1.99.11)
3,4-dihydroxy-2-butanone-4-phosphate synthase (4.1.99.12)
(6-4)DNA photolyase (4.1.99.13)
spore photoproduct lyase (4.1.99.14)
S-specific spore photoproduct lyase (4.1.99.15)
geosmin synthase (4.1.99.16)
phosphomethylpyrimidine synthase (4.1.99.17)
cyclic pyranopterin phosphate synthase (4.1.99.18)
2-iminoacetate synthase (4.1.99.19)
3-amino-4-hydroxybenzoate synthase (4.1.99.20)
(5-formylfuran-3-yl)methyl phosphate synthase (4.1.99.21)
GTP 3',8-cyclase (4.1.99.22)
5-hydroxybenzimidazole synthase (4.1.99.23)
L-tyrosine isonitrile synthase (4.1.99.24)
L-tryptophan isonitrile synthase (4.1.99.25)
3-amino-5-[(4-hydroxyphenyl)methyl]-4,4-dimethylpyrrolidin-2-one synthase (4.1.99.26)
carbonic anhydrase (4.2.1.1)
fumarate hydratase (4.2.1.2)
aconitate hydratase (4.2.1.3)
citrate dehydratase (4.2.1.4)
Arabinonate dehydratase (4.2.1.5)
omega5(Z)-etheroleic acid synthase (4.2.1.B5)
(11Z)-etheroleic acid synthase (4.2.1.B6)
galactonate dehydratase (4.2.1.6)
(8Z)-colneleic acid synthase (4.2.1.B7)
altronate dehydratase (4.2.1.7)
etheroleic acid synthase (4.2.1.B8)
mannonate dehydratase (4.2.1.8)
colneleic acid/etheroleic acid synthase (4.2.1.B9)
dihydroxy-acid dehydratase (4.2.1.9)
3-dehydroquinate dehydratase (4.2.1.10)
phosphopyruvate hydratase (4.2.1.11)
phosphogluconate dehydratase (4.2.1.12)
L-serine dehydratase (4.2.1.13)
D-serine dehydratase (4.2.1.14)
homoserine dehydratase (4.2.1.15)
threonine dehydratase (4.2.1.16)
enoyl-CoA hydratase (4.2.1.17)
methylglutaconyl-CoA hydratase (4.2.1.18)
imidazoleglycerol-phosphate dehydratase (4.2.1.19)
onoceroid synthase (4.2.1.B20)
tryptophan synthase (4.2.1.20)
cystathionine beta-synthase (4.2.1.21)
cystathionine beta-synthase (4.2.1.22)
galactarate dehydratase (2-oxo-D-threo-4,5-dihydroadipate) (4.2.1.B22)
methylcysteine synthase (4.2.1.23)
porphobilinogen synthase (4.2.1.24)
L-Arabinonate dehydratase (4.2.1.25)
(R)-2-hydroxyglutaryl-CoA dehydratase (4.2.1.B26)
aminodeoxygluconate dehydratase (4.2.1.26)
2-nitro-1-(4-nitrophenyl)ethanol synthase (4.2.1.B27)
acetylenecarboxylate hydratase (4.2.1.27)
propanediol dehydratase (4.2.1.28)
tetrahymanol synthase (hopene) (4.2.1.B28)
indoleacetaldoxime dehydratase (4.2.1.29)
vermelone dehydratase (4.2.1.B29)
glycerol dehydratase (4.2.1.30)
maleate hydratase (4.2.1.31)
L(+)-tartrate dehydratase (4.2.1.32)
3-isopropylmalate dehydratase (4.2.1.33)
(S)-2-methylmalate dehydratase (4.2.1.34)
(R)-2-methylmalate dehydratase (4.2.1.35)
homoaconitate hydratase (4.2.1.36)
trans-epoxysuccinate hydratase (4.2.1.37)
erythro-3-hydroxyaspartate dehydratase (4.2.1.38)
gluconate dehydratase (4.2.1.39)
glucarate dehydratase (4.2.1.40)
5-dehydro-4-deoxyglucarate dehydratase (4.2.1.41)
galactarate dehydratase (4.2.1.42)
2-dehydro-3-deoxy-L-arabinonate dehydratase (4.2.1.43)
myo-inosose-2 dehydratase (4.2.1.44)
CDP-glucose 4,6-dehydratase (4.2.1.45)
dTDP-glucose 4,6-dehydratase (4.2.1.46)
GDP-mannose 4,6-dehydratase (4.2.1.47)
D-glutamate cyclase (4.2.1.48)
urocanate hydratase (4.2.1.49)
pyrazolylalanine synthase (4.2.1.50)
prephenate dehydratase (4.2.1.51)
dihydrodipicolinate synthase (4.2.1.52)
oleate hydratase (4.2.1.53)
lactoyl-CoA dehydratase (4.2.1.54)
3-hydroxybutyryl-CoA dehydratase (4.2.1.55)
itaconyl-CoA hydratase (4.2.1.56)
Isohexenylglutaconyl-CoA hydratase (4.2.1.57)
crotonoyl-[acyl-carrier-protein] hydratase (4.2.1.58)
3-hydroxyacyl-[acyl-carrier-protein] dehydratase (4.2.1.59)
3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (4.2.1.60)
3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase (4.2.1.61)
5alpha-Hydroxysteroid dehydratase (4.2.1.62)
epoxide hydratase (4.2.1.63)
arene-oxide hydratase (4.2.1.64)
3-Cyanoalanine hydratase (4.2.1.65)
cyanide hydratase (4.2.1.66)
D-fuconate dehydratase (4.2.1.67)
L-fuconate dehydratase (4.2.1.68)
cyanamide hydratase (4.2.1.69)
pseudouridylate synthase (4.2.1.70)
acetylenecarboxylate hydratase (4.2.1.71)
acetylenedicarboxylate hydratase (4.2.1.72)
protoaphin-aglucone dehydratase (cyclizing) (4.2.1.73)
medium-chain-enoyl-CoA hydratase (4.2.1.74)
uroporphyrinogen-III synthase (4.2.1.75)
UDP-glucose 4,6-dehydratase (4.2.1.76)
trans-L-3-hydroxyproline dehydratase (4.2.1.77)
(S)-norcoclaurine synthase (4.2.1.78)
2-methylcitrate dehydratase (4.2.1.79)
2-oxopent-4-enoate hydratase (4.2.1.80)
D(-)-tartrate dehydratase (4.2.1.81)
xylonate dehydratase (4.2.1.82)
4-oxalomesaconate hydratase (4.2.1.83)
nitrile hydratase (4.2.1.84)
dimethylmaleate hydratase (4.2.1.85)
16-dehydroprogesterone hydratase (4.2.1.86)
octopamine dehydratase (4.2.1.87)
synephrine dehydratase (4.2.1.88)
carnitine dehydratase (4.2.1.89)
L-rhamnonate dehydratase (4.2.1.90)
arogenate dehydratase (4.2.1.91)
hydroperoxide dehydratase (4.2.1.92)
ATP-dependent NAD(P)H-hydrate dehydratase (4.2.1.93)
scytalone dehydratase (4.2.1.94)
kievitone hydratase (4.2.1.95)
4a-hydroxytetrahydrobiopterin dehydratase (4.2.1.96)
phaseollidin hydratase (4.2.1.97)
16alpha-hydroxyprogesterone dehydratase (4.2.1.98)
2-methylisocitrate dehydratase (4.2.1.99)
cyclohexa-1,5-dienecarbonyl-CoA hydratase (4.2.1.100)
trans-feruloyl-CoA hydratase (4.2.1.101)
cyclohexa-1,5-dienecarbonyl-CoA hydratase (4.2.1.102)
cyclohexyl-isocyanide hydratase (4.2.1.103)
cyanase (4.2.1.104)
2-hydroxyisoflavanone dehydratase (4.2.1.105)
bile-acid 7alpha-dehydratase (4.2.1.106)
3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase (4.2.1.107)
ectoine synthase (4.2.1.108)
methylthioribulose 1-phosphate dehydratase (4.2.1.109)
aldos-2-ulose dehydratase (4.2.1.110)
1,5-anhydro-D-fructose dehydratase (4.2.1.111)
acetylene hydratase (4.2.1.112)
o-succinylbenzoate synthase (4.2.1.113)
methanogen homoaconitase (4.2.1.114)
UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (4.2.1.115)
3-hydroxypropionyl-CoA dehydratase (4.2.1.116)
2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) (4.2.1.117)
3-dehydroshikimate dehydratase (4.2.1.118)
enoyl-CoA hydratase 2 (4.2.1.119)
4-hydroxybutanoyl-CoA dehydratase (4.2.1.120)
colneleate synthase (4.2.1.121)
tryptophan synthase (indole-salvaging) (4.2.1.122)
tetrahymanol synthase (4.2.1.123)
arabidiol synthase (4.2.1.124)
dammarenediol II synthase (4.2.1.125)
N-acetylmuramic acid 6-phosphate etherase (4.2.1.126)
linalool dehydratase (4.2.1.127)
lupan-3beta,20-diol synthase (4.2.1.128)
squalene-hopanol cyclase (4.2.1.129)
D-lactate dehydratase (4.2.1.130)
carotenoid 1,2-hydratase (4.2.1.131)
2-hydroxyhexa-2,4-dienoate hydratase (4.2.1.132)
copal-8-ol diphosphate hydratase (4.2.1.133)
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase (4.2.1.134)
UDP-N-acetylglucosamine 4,6-dehydratase (configuration-retaining) (4.2.1.135)
ADP-dependent NAD(P)H-hydrate dehydratase (4.2.1.136)
sporulenol synthase (4.2.1.137)
(+)-caryolan-1-ol synthase (4.2.1.138)
pterocarpan synthase (4.2.1.139)
gluconate/galactonate dehydratase (4.2.1.140)
2-dehydro-3-deoxy-D-arabinonate dehydratase (4.2.1.141)
5'-oxoaverantin cyclase (4.2.1.142)
versicolorin B synthase (4.2.1.143)
3-amino-5-hydroxybenzoate synthase (4.2.1.144)
capreomycidine synthase (4.2.1.145)
L-galactonate dehydratase (4.2.1.146)
5,6,7,8-tetrahydromethanopterin hydro-lyase (4.2.1.147)
2-methylfumaryl-CoA hydratase (4.2.1.148)
crotonobetainyl-CoA hydratase (4.2.1.149)
short-chain-enoyl-CoA hydratase (4.2.1.150)
chorismate dehydratase (4.2.1.151)
hydroperoxy icosatetraenoate dehydratase (4.2.1.152)
3-methylfumaryl-CoA hydratase (4.2.1.153)
tetracenomycin F2 cyclase (4.2.1.154)
(methylthio)acryloyl-CoA hydratase (4.2.1.155)
L-talarate dehydratase (4.2.1.156)
(R)-2-hydroxyisocaproyl-CoA dehydratase (4.2.1.157)
galactarate dehydratase (D-threo-forming) (4.2.1.158)
dTDP-4-dehydro-6-deoxy-alpha-D-glucopyranose 2,3-dehydratase (4.2.1.159)
2,5-diamino-6-(5-phospho-D-ribosylamino)pyrimidin-4(3H)-one isomerase/dehydratase (4.2.1.160)
bisanhydrobacterioruberin hydratase (4.2.1.161)
6-deoxy-6-sulfo-D-gluconate dehydratase (4.2.1.162)
2-oxo-hept-4-ene-1,7-dioate hydratase (4.2.1.163)
dTDP-4-dehydro-2,6-dideoxy-D-glucose 3-dehydratase (4.2.1.164)
chlorophyllide a 31-hydratase (4.2.1.165)
phosphinomethylmalate isomerase (4.2.1.166)
(R)-2-hydroxyglutaryl-CoA dehydratase (4.2.1.167)
GDP-4-dehydro-6-deoxy-alpha-D-mannose 3-dehydratase (4.2.1.168)
3-vinyl bacteriochlorophyllide d 31-hydratase (4.2.1.169)
2-(omega-methylthio)alkylmalate dehydratase (4.2.1.170)
cis-L-3-hydroxyproline dehydratase (4.2.1.171)
trans-4-hydroxy-L-proline dehydratase (4.2.1.172)
ent-8alpha-hydroxylabd-13-en-15-yl diphosphate synthase (4.2.1.173)
peregrinol diphosphate synthase (4.2.1.174)
phenyllactyl-CoA dehydratase (4.2.1.175)
L-lyxonate dehydratase (4.2.1.176)
(2S)-3-sulfopropanediol dehydratase (4.2.1.177)
difructose-dianhydride-III synthase (4.2.1.178)
difructose-anhydride-I synthase (4.2.1.179)
(E)-benzylidenesuccinyl-CoA hydratase (4.2.1.180)
hyaluronate lyase (4.2.2.1)
pectate lyase (4.2.2.2)
mannuronate-specific alginate lyase (4.2.2.3)
chondroitin ABC lyase (4.2.2.4)
chondroitin AC lyase (4.2.2.5)
muropeptide lyase (4.2.2.B6)
oligogalacturonide lyase (4.2.2.6)
heparin lyase (4.2.2.7)
mannuronate-specific alginate exolyase (4.2.2.B7)
heparin-sulfate lyase (4.2.2.8)
pectate disaccharide-lyase (4.2.2.9)
pectin lyase (4.2.2.10)
guluronate-specific alginate lyase (4.2.2.11)
xanthan lyase (4.2.2.12)
exo-(1->4)-alpha-D-glucan lyase (4.2.2.13)
glucuronan lyase (4.2.2.14)
anhydrosialidase (4.2.2.15)
levan fructotransferase (DFA-IV-forming) (4.2.2.16)
inulin fructotransferase (DFA-I-forming) (4.2.2.17)
inulin fructotransferase (DFA-III-forming) (4.2.2.18)
chondroitin B lyase (4.2.2.19)
chondroitin-sulfate-ABC endolyase (4.2.2.20)
chondroitin-sulfate-ABC exolyase (4.2.2.21)
pectate trisaccharide-lyase (4.2.2.22)
rhamnogalacturonan endolyase (4.2.2.23)
rhamnogalacturonan exolyase (4.2.2.24)
gellan lyase (4.2.2.25)
oligo-alginate lyase (4.2.2.26)
pectin monosaccharide-lyase (4.2.2.27)
threonine synthase (4.2.3.1)
ethanolamine-phosphate phospho-lyase (4.2.3.2)
methylglyoxal synthase (4.2.3.3)
3-dehydroquinate synthase (4.2.3.4)
chorismate synthase (4.2.3.5)
trichodiene synthase (4.2.3.6)
pentalenene synthase (4.2.3.7)
casbene synthase (4.2.3.8)
aristolochene synthase (4.2.3.9)
(-)-endo-fenchol synthase (4.2.3.10)
sabinene-hydrate synthase (4.2.3.11)
6-pyruvoyltetrahydropterin synthase (4.2.3.12)
(+)-delta-cadinene synthase (4.2.3.13)
pinene synthase (4.2.3.14)
myrcene synthase (4.2.3.15)
(4S)-limonene synthase (4.2.3.16)
(+)-2-epi-prezizaene synthase (4.2.3.B17)
taxadiene synthase (4.2.3.17)
(-)-alpha-cedrene synthase (4.2.3.B18)
abieta-7,13-diene synthase (4.2.3.18)
(-)-beta-curcumene synthase (4.2.3.B19)
ent-kaurene synthase (4.2.3.19)
(R)-limonene synthase (4.2.3.20)
vetispiradiene synthase (4.2.3.21)
germacradienol synthase (4.2.3.22)
germacrene-A synthase (4.2.3.23)
neocembrene synthase (4.2.3.B23)
amorpha-4,11-diene synthase (4.2.3.24)
isopimaradiene synthase (4.2.3.B25)
S-linalool synthase (4.2.3.25)
R-linalool synthase (4.2.3.26)
sclarene synthase (4.2.3.B26)
isoprene synthase (4.2.3.27)
trimethyl-methylidene-(3-methylidenepentenyl)decahydronaphthalene synthase (4.2.3.B27)
ent-cassa-12,15-diene synthase (4.2.3.28)
tetramethyl-(3-methylidenepentenyl)-octahydronaphthalene synthase (4.2.3.B28)
(Z)-biformene synthase (4.2.3.B29)
ent-sandaracopimaradiene synthase (4.2.3.29)
(+)-copalol synthase (4.2.3.B30)
ent-pimara-8(14),15-diene synthase (4.2.3.30)
ent-pimara-9(11),15-diene synthase (4.2.3.31)
manool synthase (4.2.3.B31)
13-epi-manool synthase (4.2.3.B32)
levopimaradiene synthase (4.2.3.32)
(-)-ent-copalol synthase (4.2.3.B33)
stemar-13-ene synthase (4.2.3.33)
ent-manool synthase (4.2.3.B34)
stemod-13(17)-ene synthase (4.2.3.34)
syn-copalol synthase (4.2.3.B35)
syn-pimara-7,15-diene synthase (4.2.3.35)
(13S)-vitexifolin A synthase (4.2.3.B36)
terpentetriene synthase (4.2.3.36)
epi-isozizaene synthase (4.2.3.37)
alpha-bisabolene synthase (4.2.3.38)
epi-cedrol synthase (4.2.3.39)
(E)-beta-ocimene synthase (4.2.3.B40)
(Z)-gamma-bisabolene synthase (4.2.3.40)
elisabethatriene synthase (4.2.3.41)
aphidicolan-16beta-ol synthase (4.2.3.42)
fusicocca-2,10(14)-diene synthase (4.2.3.43)
isopimara-7,15-diene synthase (4.2.3.44)
phyllocladan-16alpha-ol synthase (4.2.3.45)
alpha-farnesene synthase (4.2.3.46)
beta-farnesene synthase (4.2.3.47)
(3S,6E)-nerolidol synthase (4.2.3.48)
(3R,6E)-nerolidol synthase (4.2.3.49)
(+)-alpha-santalene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing] (4.2.3.50)
beta-phellandrene synthase (neryl-diphosphate-cyclizing) (4.2.3.51)
(4S)-beta-phellandrene synthase (geranyl-diphosphate-cyclizing) (4.2.3.52)
(+)-endo-beta-bergamotene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing] (4.2.3.53)
(-)-endo-alpha-bergamotene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing] (4.2.3.54)
(S)-beta-bisabolene synthase (4.2.3.55)
gamma-humulene synthase (4.2.3.56)
(-)-beta-caryophyllene synthase (4.2.3.57)
longifolene synthase (4.2.3.58)
(E)-gamma-bisabolene synthase (4.2.3.59)
germacrene C synthase (4.2.3.60)
5-epiaristolochene synthase (4.2.3.61)
(-)-gamma-cadinene synthase [(2Z,6E)-farnesyl diphosphate cyclizing] (4.2.3.62)
(+)-cubenene synthase (4.2.3.63)
(+)-epicubenol synthase (4.2.3.64)
zingiberene synthase (4.2.3.65)
beta-selinene cyclase (4.2.3.66)
ent-beyerene synthase (4.2.3.B66)
(13E)-labda-7,13-dien-15-yl diphosphate synthase (4.2.3.B67)
cis-muuroladiene synthase (4.2.3.67)
beta-eudesmol synthase (4.2.3.68)
spiroalbatene synthase (4.2.3.B68)
(+)-alpha-barbatene synthase (4.2.3.69)
(Z)-beta-ocimene synthase (4.2.3.B69)
kaurene synthase 2 (4.2.3.B70)
patchoulol synthase (4.2.3.70)
(E,E)-germacrene B synthase (4.2.3.71)
alpha-gurjunene synthase (4.2.3.72)
valencene synthase (4.2.3.73)
presilphiperfolanol synthase (4.2.3.74)
(-)-germacrene D synthase (4.2.3.75)
(+)-delta-selinene synthase (4.2.3.76)
(+)-germacrene D synthase (4.2.3.77)
beta-chamigrene synthase (4.2.3.78)
thujopsene synthase (4.2.3.79)
alpha-longipinene synthase (4.2.3.80)
exo-alpha-bergamotene synthase (4.2.3.81)
alpha-santalene synthase (4.2.3.82)
beta-santalene synthase (4.2.3.83)
10-epi-gamma-eudesmol synthase (4.2.3.84)
alpha-eudesmol synthase (4.2.3.85)
7-epi-alpha-selinene synthase (4.2.3.86)
alpha-guaiene synthase (4.2.3.87)
viridiflorene synthase (4.2.3.88)
(+)-beta-caryophyllene synthase (4.2.3.89)
5-epi-alpha-selinene synthase (4.2.3.90)
cubebol synthase (4.2.3.91)
(+)-gamma-cadinene synthase (4.2.3.92)
delta-guaiene synthase (4.2.3.93)
gamma-curcumene synthase (4.2.3.94)
(-)-alpha-cuprenene synthase (4.2.3.95)
avermitilol synthase (4.2.3.96)
(-)-delta-cadinene synthase (4.2.3.97)
(+)-T-muurolol synthase (4.2.3.98)
labdatriene synthase (4.2.3.99)
bicyclogermacrene synthase (4.2.3.100)
7-epi-sesquithujene synthase (4.2.3.101)
sesquithujene synthase (4.2.3.102)
ent-isokaurene synthase (4.2.3.103)
alpha-humulene synthase (4.2.3.104)
tricyclene synthase (4.2.3.105)
(E)-beta-ocimene synthase (4.2.3.106)
(+)-car-3-ene synthase (4.2.3.107)
1,8-cineole synthase (4.2.3.108)
(-)-sabinene synthase (4.2.3.109)
(+)-sabinene synthase (4.2.3.110)
(-)-alpha-terpineol synthase (4.2.3.111)
(+)-alpha-terpineol synthase (4.2.3.112)
terpinolene synthase (4.2.3.113)
gamma-terpinene synthase (4.2.3.114)
alpha-terpinene synthase (4.2.3.115)
(+)-camphene synthase (4.2.3.116)
(-)-camphene synthase (4.2.3.117)
2-methylisoborneol synthase (4.2.3.118)
(-)-alpha-pinene synthase (4.2.3.119)
(-)-beta-pinene synthase (4.2.3.120)
(+)-alpha-pinene synthase (4.2.3.121)
(+)-beta-pinene synthase (4.2.3.122)
beta-sesquiphellandrene synthase (4.2.3.123)
2-deoxy-scyllo-inosose synthase (4.2.3.124)
alpha-muurolene synthase (4.2.3.125)
gamma-muurolene synthase (4.2.3.126)
beta-copaene synthase (4.2.3.127)
beta-cubebene synthase (4.2.3.128)
(+)-sativene synthase (4.2.3.129)
tetraprenyl-beta-curcumene synthase (4.2.3.130)
miltiradiene synthase (4.2.3.131)
neoabietadiene synthase (4.2.3.132)
alpha-copaene synthase (4.2.3.133)
5-phosphonooxy-L-lysine phospho-lyase (4.2.3.134)
DELTA6-protoilludene synthase (4.2.3.135)
alpha-isocomene synthase (4.2.3.136)
(E)-2-epi-beta-caryophyllene synthase (4.2.3.137)
(+)-epi-alpha-bisabolol synthase (4.2.3.138)
valerena-4,7(11)-diene synthase (4.2.3.139)
cis-abienol synthase (4.2.3.140)
sclareol synthase (4.2.3.141)
7-epizingiberene synthase [(2Z,6Z)-farnesyl diphosphate cyclizing] (4.2.3.142)
kunzeaol synthase (4.2.3.143)
geranyllinalool synthase (4.2.3.144)
ophiobolin F synthase (4.2.3.145)
cyclooctat-9-en-7-ol synthase (4.2.3.146)
pimaradiene synthase (4.2.3.147)
cembrene C synthase (4.2.3.148)
nephthenol synthase (4.2.3.149)
cembrene A synthase (4.2.3.150)
pentamethylcyclopentadecatrienol synthase (4.2.3.151)
2-epi-5-epi-valiolone synthase (4.2.3.152)
(5-formylfuran-3-yl)methyl phosphate synthase (4.2.3.153)
demethyl-4-deoxygadusol synthase (4.2.3.154)
2-epi-valiolone synthase (4.2.3.155)
hydroxysqualene synthase (4.2.3.156)
(+)-isoafricanol synthase (4.2.3.157)
(-)-spiroviolene synthase (4.2.3.158)
tsukubadiene synthase (4.2.3.159)
(2S,3R,6S,9S)-(-)-protoillud-7-ene synthase (4.2.3.160)
(3S)-(+)-asterisca-2(9),6-diene synthase (4.2.3.161)
(-)-alpha-amorphene synthase (4.2.3.162)
(+)-corvol ether B synthase (4.2.3.163)
(+)-eremophilene synthase (4.2.3.164)
(1R,4R,5S)-(-)-guaia-6,10(14)-diene synthase (4.2.3.165)
(+)-(1E,4E,6S,7R)-germacra-1(10),4-dien-6-ol synthase (4.2.3.166)
dolabella-3,7-dien-18-ol synthase (4.2.3.167)
dolathalia-3,7,11-triene synthase (4.2.3.168)
7-epi-alpha-eudesmol synthase (4.2.3.169)
4-epi-cubebol synthase (4.2.3.170)
(+)-corvol ether A synthase (4.2.3.171)
10-epi-juneol synthase (4.2.3.172)
tau-cadinol synthase (4.2.3.173)
(2E,6E)-hedycaryol synthase (4.2.3.174)
10-epi-cubebol synthase (4.2.3.175)
sesterfisherol synthase (4.2.3.176)
beta-thujene synthase (4.2.3.177)
stellata-2,6,19-triene synthase (4.2.3.178)
guaia-4,6-diene synthase (4.2.3.179)
pseudolaratriene synthase (4.2.3.180)
selina-4(15),7(11)-diene synthase (4.2.3.181)
pristinol synthase (4.2.3.182)
nezukol synthase (4.2.3.183)
5-hydroxy-alpha-gurjunene synthase (4.2.3.184)
ent-atiserene synthase (4.2.3.185)
ent-13-epi-manoyl oxide synthase (4.2.3.186)
(2Z,6E)-hedycaryol synthase (4.2.3.187)
beta-geranylfarnesene synthase (4.2.3.188)
9,13-epoxylabda-14-ene synthase (4.2.3.189)
manoyl oxide synthase (4.2.3.190)
cycloaraneosene synthase (4.2.3.191)
labda-7,13(16),14-triene synthase (4.2.3.192)
(12E)-labda-8(17),12,14-triene synthase (4.2.3.193)
(-)-drimenol synthase (4.2.3.194)
rhizathalene A synthase (4.2.3.195)
dolabradiene synthase (4.2.3.196)
eudesmane-5,11-diol synthase (4.2.3.197)
alpha-selinene synthase (4.2.3.198)
(-)-5-epieremophilene synthase (4.2.3.199)
beta-pinacene synthase (4.2.3.200)
hydropyrene synthase (4.2.3.201)
hydropyrenol synthase (4.2.3.202)
isoelisabethatriene synthase (4.2.3.203)
valerianol synthase (4.2.3.204)
sodorifen synthase (4.2.3.205)
DNA 5'-deoxyribose phosphate lyase (4.2.99.B1)
hyaluronate lyase (4.2.99.1)
threonine synthase (4.2.99.2)
pectate lyase (4.2.99.3)
alginate lyase (4.2.99.4)
Polyglucuronide lyase (4.2.99.5)
Chondroitin sulfate lyase (4.2.99.6)
ethanolamine-phosphate phospho-lyase (4.2.99.7)
cysteine synthase (4.2.99.8)
O-succinylhomoserine (thiol)-lyase (4.2.99.9)
O-acetylhomoserine (thiol)-lyase (4.2.99.10)
methylglyoxal synthase (4.2.99.11)
carboxymethyloxysuccinate lyase (4.2.99.12)
beta-(9-cytokinin)-alanine synthase (4.2.99.13)
beta-pyrazolylalanine synthase (acetylserine) (4.2.99.14)
L-mimosine synthase (4.2.99.15)
uracilylalanine synthase (4.2.99.16)
thermopsin (4.2.99.17)
DNA-(apurinic or apyrimidinic site) lyase (4.2.99.18)
2-hydroxypropyl-CoM lyase (4.2.99.19)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (4.2.99.20)
isochorismate lyase (4.2.99.21)
tuliposide A-converting enzyme (4.2.99.22)
tuliposide B-converting enzyme (4.2.99.23)
thebaine synthase (4.2.99.24)
aspartate ammonia-lyase (4.3.1.1)
imidazole glycerol phosphate synthase (4.3.1.B2)
methylaspartate ammonia-lyase (4.3.1.2)
histidine ammonia-lyase (4.3.1.3)
formimidoyltetrahydrofolate cyclodeaminase (4.3.1.4)
phenylalanine ammonia-lyase (4.3.1.5)
beta-alanyl-CoA ammonia-lyase (4.3.1.6)
ethanolamine ammonia-lyase (4.3.1.7)
hydroxymethylbilane synthase (4.3.1.8)
glucosaminate ammonia-lyase (4.3.1.9)
serine-sulfate ammonia-lyase (4.3.1.10)
dihydroxyphenylalanine ammonia-lyase (4.3.1.11)
ornithine cyclodeaminase (4.3.1.12)
carbamoyl-serine ammonia-lyase (4.3.1.13)
3-Aminobutyryl-CoA ammonia-lyase (4.3.1.14)
Diaminopropionate ammonia-lyase (4.3.1.15)
threo-3-hydroxy-L-aspartate ammonia-lyase (4.3.1.16)
L-serine ammonia-lyase (4.3.1.17)
D-Serine ammonia-lyase (4.3.1.18)
threonine ammonia-lyase (4.3.1.19)
erythro-3-hydroxy-L-aspartate ammonia-lyase (4.3.1.20)
aminodeoxygluconate ammonia-lyase (4.3.1.21)
3,4-dihydroxyphenylalanine reductive deaminase (4.3.1.22)
tyrosine ammonia-lyase (4.3.1.23)
phenylalanine ammonia-lyase (4.3.1.24)
phenylalanine/tyrosine ammonia-lyase (4.3.1.25)
chromopyrrolate synthase (4.3.1.26)
threo-3-hydroxy-D-aspartate ammonia-lyase (4.3.1.27)
L-lysine cyclodeaminase (4.3.1.28)
D-glucosaminate-6-phosphate ammonia-lyase (4.3.1.29)
dTDP-4-amino-4,6-dideoxy-D-glucose ammonia-lyase (4.3.1.30)
L-tryptophan ammonia lyase (4.3.1.31)
7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase (4.3.1.32)
argininosuccinate lyase (4.3.2.1)
adenylosuccinate lyase (4.3.2.2)
ureidoglycolate lyase (4.3.2.3)
purine imidazole-ring cyclase (4.3.2.4)
peptidylamidoglycolate lyase (4.3.2.5)
gamma-L-glutamyl-butirosin B gamma-glutamyl cyclotransferase (4.3.2.6)
glutathione-specific gamma-glutamylcyclotransferase (4.3.2.7)
gamma-glutamylamine cyclotransferase (4.3.2.8)
gamma-glutamylcyclotransferase (4.3.2.9)
imidazole glycerol-phosphate synthase (4.3.2.10)
(3R)-3-[(carboxylmethyl)amino]fatty acid synthase (4.3.2.11)
3-ketovalidoxylamine C-N-lyase (4.3.3.1)
strictosidine synthase (4.3.3.2)
deacetylisoipecoside synthase (4.3.3.3)
deacetylipecoside synthase (4.3.3.4)
4'-demethylrebeccamycin synthase (4.3.3.5)
pyridoxal 5'-phosphate synthase (glutamine hydrolysing) (4.3.3.6)
4-hydroxy-tetrahydrodipicolinate synthase (4.3.3.7)
cyanate lyase (4.3.99.1)
carboxybiotin decarboxylase (4.3.99.2)
7-carboxy-7-deazaguanine synthase (4.3.99.3)
choline trimethylamine-lyase (4.3.99.4)
nitrosuccinate lyase (4.3.99.5)
cystathionine gamma-lyase (4.4.1.1)
holocytochrome-c1 synthase (4.4.1.B1)
homocysteine desulfhydrase (4.4.1.2)
dimethylpropiothetin dethiomethylase (4.4.1.3)
alliin lyase (4.4.1.4)
SAM lyase (4.4.1.B4)
lactoylglutathione lyase (4.4.1.5)
S-alkylcysteine lyase (4.4.1.6)
S-(Hydroxyalkyl)glutathione lyase (4.4.1.7)
cystathionine beta-lyase (4.4.1.8)
L-3-cyanoalanine synthase (4.4.1.9)
cysteine lyase (4.4.1.10)
methionine gamma-lyase (4.4.1.11)
sulfoacetaldehyde lyase (4.4.1.12)
cysteine-S-conjugate beta-lyase (4.4.1.13)
1-aminocyclopropane-1-carboxylate synthase (4.4.1.14)
D-cysteine desulfhydrase (4.4.1.15)
selenocysteine lyase (4.4.1.16)
Holocytochrome-c synthase (4.4.1.17)
prenylcysteine lyase (4.4.1.18)
phosphosulfolactate synthase (4.4.1.19)
leukotriene-C4 synthase (4.4.1.20)
S-ribosylhomocysteine lyase (4.4.1.21)
S-(hydroxymethyl)glutathione synthase (4.4.1.22)
2-hydroxypropyl-CoM lyase (4.4.1.23)
(2R)-sulfolactate sulfo-lyase (4.4.1.24)
L-cysteate sulfo-lyase (4.4.1.25)
olivetolic acid cyclase (4.4.1.26)
carbon disulfide lyase (4.4.1.27)
L-cysteine desulfidase (4.4.1.28)
phycobiliprotein cysteine-84 phycobilin lyase (4.4.1.29)
phycobiliprotein beta-cysteine-155 phycobilin lyase (4.4.1.30)
phycoerythrocyanin alpha-cysteine-84 phycoviolobilin lyase/isomerase (4.4.1.31)
C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase (4.4.1.32)
R-phycocyanin alpha-cysteine-84 phycourobilin lyase/isomerase (4.4.1.33)
isoprene-epoxide-glutathione S-transferase (4.4.1.34)
L-cystine beta-lyase (4.4.1.35)
hercynylcysteine S-oxide lyase (4.4.1.36)
pyridinium-3,5-bisthiocarboxylic acid mononucleotide synthase (4.4.1.37)
isethionate sulfite-lyase (4.4.1.38)
C-phycoerythrin alpha-cysteine-82 phycoerythrobilin lyase (4.4.1.39)
C-phycoerythrin beta-cysteine-48/59 phycoerythrobilin lyase (4.4.1.40)
(2S)-3-sulfopropanediol sulfolyase (4.4.1.41)
DDT-dehydrochlorinase (4.5.1.1)
hexachlorocyclohexane dehydrochlorinase (4.5.1.B1)
3-chloro-D-alanine dehydrochlorinase (4.5.1.2)
dichloromethane dehalogenase (4.5.1.3)
L-2-amino-4-chloropent-4-enoate dehydrochlorinase (4.5.1.4)
S-carboxymethylcysteine synthase (4.5.1.5)
adenylate cyclase (4.6.1.1)
guanylate cyclase (4.6.1.2)
3-dehydroquinate synthase (4.6.1.3)
chorismate synthase (4.6.1.4)
pentalenene synthase (4.6.1.5)
cytidylate cyclase (4.6.1.6)
casbene synthase (4.6.1.7)
(-)-endo-fenchol synthase (4.6.1.8)
sabinene-hydrate synthase (4.6.1.9)
6-pyruvoyltetrahydropterin synthase (4.6.1.10)
(+)-delta-cadinene synthase (4.6.1.11)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (4.6.1.12)
phosphatidylinositol diacylglycerol-lyase (4.6.1.13)
glycosylphosphatidylinositol diacylglycerol-lyase (4.6.1.14)
FAD-AMP lyase (cyclizing) (4.6.1.15)
tRNA-intron lyase (4.6.1.16)
cyclic pyranopterin monophosphate synthase (4.6.1.17)
pancreatic ribonuclease (4.6.1.18)
ribonuclease T2 (4.6.1.19)
ribonuclease U2 (4.6.1.20)
Enterobacter ribonuclease (4.6.1.21)
Bacillus subtilis ribonuclease (4.6.1.22)
ribotoxin (4.6.1.23)
ribonuclease T1 (4.6.1.24)
bacteriophage T4 restriction endoribonuclease RegB (4.6.1.25)
uridylate cyclase (4.6.1.26)
alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase (4.7.1.1)
L-piperazate synthase (4.8.1.1)
aliphatic aldoxime dehydratase (4.8.1.2)
indoleacetaldoxime dehydratase (4.8.1.3)
phenylacetaldoxime dehydratase (4.8.1.4)
protoporphyrin ferrochelatase (4.98.1.1)
protoporphyrin ferrochelatase (4.99.1.1)
alkylmercury lyase (4.99.1.2)
vitamin B12 decyanase (4.99.1.B2)
sirohydrochlorin cobaltochelatase (4.99.1.3)
sirohydrochlorin ferrochelatase (4.99.1.4)
aliphatic aldoxime dehydratase (4.99.1.5)
indoleacetaldoxime dehydratase (4.99.1.6)
phenylacetaldoxime dehydratase (4.99.1.7)
heme ligase (4.99.1.8)
coproporphyrin ferrochelatase (4.99.1.9)
magnesium dechelatase (4.99.1.10)
sirohydrochlorin nickelchelatase (4.99.1.11)
pyridinium-3,5-bisthiocarboxylic acid mononucleotide nickel chelatase (4.99.1.12)
alanine racemase (5.1.1.1)
methionine racemase (5.1.1.2)
glutamate racemase (5.1.1.3)
proline racemase (5.1.1.4)
lysine racemase (5.1.1.5)
threonine racemase (5.1.1.6)
diaminopimelate epimerase (5.1.1.7)
4-hydroxyproline epimerase (5.1.1.8)
arginine racemase (5.1.1.9)
amino-acid racemase (5.1.1.10)
phenylalanine racemase (ATP-hydrolysing) (5.1.1.11)
ornithine racemase (5.1.1.12)
aspartate racemase (5.1.1.13)
nocardicin A epimerase (5.1.1.14)
2-aminohexano-6-lactam racemase (5.1.1.15)
protein-serine epimerase (5.1.1.16)
isopenicillin-N epimerase (5.1.1.17)
serine racemase (5.1.1.18)
O-ureido-serine racemase (5.1.1.19)
L-Ala-D/L-Glu epimerase (5.1.1.20)
isoleucine 2-epimerase (5.1.1.21)
4-hydroxyproline betaine 2-epimerase (5.1.1.22)
UDP-N-acetyl-alpha-D-muramoyl-L-alanyl-L-glutamate epimerase (5.1.1.23)
histidine racemase (5.1.1.24)
lactate racemase (5.1.2.1)
mandelate racemase (5.1.2.2)
3-hydroxybutyryl-CoA epimerase (5.1.2.3)
acetoin racemase (5.1.2.4)
tartrate epimerase (5.1.2.5)
isocitrate epimerase (5.1.2.6)
tagaturonate epimerase (5.1.2.7)
aldose 1-epimerase (5.1.3.B1)
ribulose-phosphate 3-epimerase (5.1.3.1)
UDP-glucose 4-epimerase (5.1.3.2)
Aldose 1-epimerase (5.1.3.3)
L-ribulose-5-phosphate 4-epimerase (5.1.3.4)
UDP-arabinose 4-epimerase (5.1.3.5)
UDP-glucuronate 4-epimerase (5.1.3.6)
UDP-N-acetylglucosamine 4-epimerase (5.1.3.7)
N-acylglucosamine 2-epimerase (5.1.3.8)
N-acylglucosamine-6-phosphate 2-epimerase (5.1.3.9)
CDP-paratose 2-epimerase (5.1.3.10)
cellobiose epimerase (5.1.3.11)
Agrobacterium tumefaciens D-psicose 3-epimerase (5.1.3.B12)
UDP-glucuronate 5'-epimerase (5.1.3.12)
dTDP-4-dehydrorhamnose 3,5-epimerase (5.1.3.13)
UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) (5.1.3.14)
glucose-6-phosphate 1-epimerase (5.1.3.15)
UDP-glucosamine 4-epimerase (5.1.3.16)
heparosan-N-sulfate-glucuronate 5-epimerase (5.1.3.17)
GDP-mannose 3,5-epimerase (5.1.3.18)
chondroitin-glucuronate 5-epimerase (5.1.3.19)
ADP-glyceromanno-heptose 6-epimerase (5.1.3.20)
maltose epimerase (5.1.3.21)
L-ribulose-5-phosphate 3-epimerase (5.1.3.22)
UDP-2,3-diacetamido-2,3-dideoxyglucuronic acid 2-epimerase (5.1.3.23)
N-acetylneuraminate epimerase (5.1.3.24)
dTDP-L-rhamnose 4-epimerase (5.1.3.25)
N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase (5.1.3.26)
dTDP-4-dehydro-6-deoxy-D-glucose 3-epimerase (5.1.3.27)
UDP-N-acetyl-L-fucosamine synthase (5.1.3.28)
L-fucose mutarotase (5.1.3.29)
D-psicose 3-epimerase (5.1.3.30)
D-tagatose 3-epimerase (5.1.3.31)
L-rhamnose mutarotase (5.1.3.32)
2-epi-5-epi-valiolone epimerase (5.1.3.33)
monoglucosyldiacylglycerol epimerase (5.1.3.34)
2-epi-5-epi-valiolone 7-phosphate 2-epimerase (5.1.3.35)
heparosan-glucuronate 5-epimerase (5.1.3.36)
mannuronan 5-epimerase (5.1.3.37)
D-erythrulose 1-phosphate 3-epimerase (5.1.3.38)
L-erythrulose 4-phosphate epimerase (5.1.3.39)
D-tagatose 6-phosphate 4-epimerase (5.1.3.40)
fructoselysine 3-epimerase (5.1.3.41)
D-glucosamine-6-phosphate 4-epimerase (5.1.3.42)
sulfoquinovose mutarotase (5.1.3.43)
mannose 2-epimerase (5.1.3.44)
methylmalonyl-CoA epimerase (5.1.99.1)
16-hydroxysteroid epimerase (5.1.99.2)
allantoin racemase (5.1.99.3)
alpha-methylacyl-CoA racemase (5.1.99.4)
hydantoin racemase (5.1.99.5)
NAD(P)H-hydrate epimerase (5.1.99.6)
dihydroneopterin triphosphate 2'-epimerase (5.1.99.7)
7,8-dihydroneopterin epimerase (5.1.99.8)
maleate isomerase (5.2.1.1)
maleylacetoacetate isomerase (5.2.1.2)
retinal isomerase (5.2.1.3)
2-methyl-cis-aconitate isomerase (5.2.1.B4)
maleylpyruvate isomerase (5.2.1.4)
linoleate isomerase (5.2.1.5)
furylfuramide isomerase (5.2.1.6)
retinol isomerase (5.2.1.7)
peptidylprolyl isomerase (5.2.1.8)
farnesol 2-isomerase (5.2.1.9)
2-Chloro-4-carboxymethylenebut-2-en-1,4-olide isomerase (5.2.1.10)
4-hydroxyphenylacetaldehyde-oxime isomerase (5.2.1.11)
zeta-carotene isomerase (5.2.1.12)
prolycopene isomerase (5.2.1.13)
beta-carotene isomerase (5.2.1.14)
triose-phosphate isomerase (5.3.1.1)
erythrose isomerase (5.3.1.2)
D-arabinose isomerase (5.3.1.3)
L-ribulose isomerase (5.3.1.B3)
D-sedoheptulose 7-phosphate diisomerase (5.3.1.B4)
L-arabinose isomerase (5.3.1.4)
xylose isomerase (5.3.1.5)
ribose-5-phosphate isomerase (5.3.1.6)
mannose isomerase (5.3.1.7)
mannose-6-phosphate isomerase (5.3.1.8)
glucose-6-phosphate isomerase (5.3.1.9)
glucosamine-6-phosphate isomerase (5.3.1.10)
acetylglucosaminephosphate isomerase (5.3.1.11)
glucuronate isomerase (5.3.1.12)
arabinose-5-phosphate isomerase (5.3.1.13)
L-rhamnose isomerase (5.3.1.14)
D-lyxose ketol-isomerase (5.3.1.15)
1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (5.3.1.16)
5-dehydro-4-deoxy-D-glucuronate isomerase (5.3.1.17)
glucose isomerase (5.3.1.18)
glucosaminephosphate isomerase (5.3.1.19)
ribose isomerase (5.3.1.20)
corticosteroid side-chain-isomerase (5.3.1.21)
Hydroxypyruvate isomerase (5.3.1.22)
S-methyl-5-thioribose-1-phosphate isomerase (5.3.1.23)
phosphoribosylanthranilate isomerase (5.3.1.24)
L-fucose isomerase (5.3.1.25)
galactose-6-phosphate isomerase (5.3.1.26)
6-phospho-3-hexuloisomerase (5.3.1.27)
D-sedoheptulose 7-phosphate isomerase (5.3.1.28)
ribose 1,5-bisphosphate isomerase (5.3.1.29)
5-deoxy-glucuronate isomerase (5.3.1.30)
sulfoquinovose isomerase (5.3.1.31)
(4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (5.3.1.32)
L-erythrulose 1-phosphate isomerase (5.3.1.33)
D-erythrulose 4-phosphate isomerase (5.3.1.34)
2-dehydrotetronate isomerase (5.3.1.35)
D-apiose isomerase (5.3.1.36)
4-deoxy-4-sulfo-D-erythrose isomerase (5.3.1.37)
phenylpyruvate tautomerase (5.3.2.1)
oxaloacetate tautomerase (5.3.2.2)
TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-deoxy-alpha-D-galactopyranose-forming) (5.3.2.3)
TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-deoxy-alpha-D-glucopyranose-forming) (5.3.2.4)
2,3-diketo-5-methylthiopentyl-1-phosphate enolase (5.3.2.5)
2-hydroxymuconate tautomerase (5.3.2.6)
ascopyrone tautomerase (5.3.2.7)
4-oxalomesaconate tautomerase (5.3.2.8)
steroid DELTA-isomerase (5.3.3.1)
isopentenyl-diphosphate DELTA-isomerase (5.3.3.2)
linoleate (10E,12Z)-isomerase (5.3.3.B2)
vinylacetyl-CoA DELTA-isomerase (5.3.3.3)
muconolactone DELTA-isomerase (5.3.3.4)
cholestenol DELTA-isomerase (5.3.3.5)
methylitaconate DELTA-isomerase (5.3.3.6)
aconitate DELTA-isomerase (5.3.3.7)
DELTA3-DELTA2-enoyl-CoA isomerase (5.3.3.8)
prostaglandin-A1 DELTA-isomerase (5.3.3.9)
5-carboxymethyl-2-hydroxymuconate DELTA-isomerase (5.3.3.10)
isopiperitenone DELTA-isomerase (5.3.3.11)
L-dopachrome isomerase (5.3.3.12)
polyenoic fatty acid isomerase (5.3.3.13)
trans-2-decenoyl-[acyl-carrier protein] isomerase (5.3.3.14)
ascopyrone tautomerase (5.3.3.15)
4-oxalomesaconate tautomerase (5.3.3.16)
trans-2,3-dihydro-3-hydroxyanthranilate isomerase (5.3.3.17)
2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (5.3.3.18)
3-[(4R)-4-hydroxycyclohexa-1,5-dien-1-yl]-2-oxopropanoate isomerase (5.3.3.19)
2-hydroxyisobutanoyl-CoA mutase (5.3.3.20)
DELTA3,5-DELTA2,4-dienoyl-CoA isomerase (5.3.3.21)
lutein isomerase (5.3.3.22)
S-methyl-5-thioribulose 1-phosphate isomerase (5.3.3.23)
protein disulfide-isomerase (5.3.4.1)
hydroperoxide isomerase (5.3.99.1)
Prostaglandin-D synthase (5.3.99.2)
prostaglandin-E synthase (5.3.99.3)
prostaglandin-I synthase (5.3.99.4)
thromboxane-A synthase (5.3.99.5)
allene-oxide cyclase (5.3.99.6)
styrene-oxide isomerase (5.3.99.7)
capsanthin/capsorubin synthase (5.3.99.8)
neoxanthin synthase (5.3.99.9)
thiazole tautomerase (5.3.99.10)
2-keto-myo-inositol isomerase (5.3.99.11)
lachrymatory-factor synthase (5.3.99.12)
Lysolecithin acylmutase (5.4.1.1)
precorrin-8X methylmutase (5.4.1.2)
2-methylfumaryl-CoA isomerase (5.4.1.3)
D-galactarolactone isomerase (5.4.1.4)
phosphoglycerate mutase (5.4.2.1)
phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) (5.4.2.2)
phosphoacetylglucosamine mutase (5.4.2.3)
Bisphosphoglycerate mutase (5.4.2.4)
phosphoglucomutase (glucose-cofactor) (5.4.2.5)
beta-Phosphoglucomutase (5.4.2.6)
phosphopentomutase (5.4.2.7)
phosphomannomutase (5.4.2.8)
phosphoenolpyruvate mutase (5.4.2.9)
phosphoglucosamine mutase (5.4.2.10)
phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (5.4.2.11)
phosphoglycerate mutase (2,3-diphosphoglycerate-independent) (5.4.2.12)
phosphogalactosamine mutase (5.4.2.13)
ornithine 4,5-aminomutase (5.4.3.1)
lysine 2,3-aminomutase (5.4.3.2)
lysine 5,6-aminomutase (5.4.3.3)
D-lysine 5,6-aminomutase (5.4.3.4)
D-ornithine 4,5-aminomutase (5.4.3.5)
tyrosine 2,3-aminomutase (5.4.3.6)
leucine 2,3-aminomutase (5.4.3.7)
glutamate-1-semialdehyde 2,1-aminomutase (5.4.3.8)
glutamate 2,3-aminomutase (5.4.3.9)
phenylalanine aminomutase (L-beta-phenylalanine forming) (5.4.3.10)
phenylalanine aminomutase (D-beta-phenylalanine forming) (5.4.3.11)
(hydroxyamino)benzene mutase (5.4.4.1)
isochorismate synthase (5.4.4.2)
3-(hydroxyamino)phenol mutase (5.4.4.3)
geraniol isomerase (5.4.4.4)
9,12-octadecadienoate 8-hydroperoxide 8R-isomerase (5.4.4.5)
9,12-octadecadienoate 8-hydroperoxide 8S-isomerase (5.4.4.6)
hydroperoxy icosatetraenoate isomerase (5.4.4.7)
linalool isomerase (5.4.4.8)
methylaspartate mutase (5.4.99.1)
methylmalonyl-CoA mutase (5.4.99.2)
multifunctional triterpene synthase (5.4.99.B2)
2-acetolactate mutase (5.4.99.3)
2-methyleneglutarate mutase (5.4.99.4)
23S rRNA pseudouridine(helix 69) synthase (5.4.99.B4)
chorismate mutase (5.4.99.5)
isochorismate synthase (5.4.99.6)
Lanosterol synthase (5.4.99.7)
cycloartenol synthase (5.4.99.8)
UDP-galactopyranose mutase (5.4.99.9)
isomaltulose synthetase (5.4.99.10)
isomaltulose synthase (5.4.99.11)
tRNA pseudouridine38-40 synthase (5.4.99.12)
isobutyryl-CoA mutase (5.4.99.13)
4-carboxymethyl-4-methylbutenolide mutase (5.4.99.14)
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase (5.4.99.15)
maltose alpha-D-glucosyltransferase (5.4.99.16)
squalene-hopene cyclase (5.4.99.17)
5-(carboxyamino)imidazole ribonucleotide mutase (5.4.99.18)
16S rRNA pseudouridine516 synthase (5.4.99.19)
23S rRNA pseudouridine2457 synthase (5.4.99.20)
23S rRNA pseudouridine2604 synthase (5.4.99.21)
23S rRNA pseudouridine2605 synthase (5.4.99.22)
multisite-specific tRNA pseudouridine synthase (5.4.99.B22)
23S rRNA pseudouridine1911/1915/1917 synthase (5.4.99.23)
23S rRNA pseudouridine955/2504/2580 synthase (5.4.99.24)
tRNA pseudouridine54 synthase (5.4.99.B25)
tRNA pseudouridine55 synthase (5.4.99.25)
tRNA pseudouridine65 synthase (5.4.99.26)
tRNA pseudouridine13 synthase (5.4.99.27)
tRNA pseudouridine32 synthase (5.4.99.28)
23S rRNA pseudouridine746 synthase (5.4.99.29)
UDP-arabinopyranose mutase (5.4.99.30)
thalianol synthase (5.4.99.31)
protostadienol synthase (5.4.99.32)
cucurbitadienol synthase (5.4.99.33)
germanicol synthase (5.4.99.34)
taraxerol synthase (5.4.99.35)
isomultiflorenol synthase (5.4.99.36)
dammaradiene synthase (5.4.99.37)
camelliol C synthase (5.4.99.38)
pre-tRNA pseudouridine35 synthase (5.4.99.B38)
beta-amyrin synthase (5.4.99.39)
tohogenol synthase (5.4.99.B39)
alpha-amyrin synthase (5.4.99.40)
astertarone A synthase (5.4.99.B40)
lupeol synthase (5.4.99.41)
orysatinol synthase (5.4.99.B41)
tRNA pseudouridine31 synthase (5.4.99.42)
21S rRNA pseudouridine2819 synthase (5.4.99.43)
mitochondrial tRNA pseudouridine27/28 synthase (5.4.99.44)
tRNA pseudouridine38/39 synthase (5.4.99.45)
shionone synthase (5.4.99.46)
parkeol synthase (5.4.99.47)
achilleol B synthase (5.4.99.48)
glutinol synthase (5.4.99.49)
friedelin synthase (5.4.99.50)
baccharis oxide synthase (5.4.99.51)
alpha-seco-amyrin synthase (5.4.99.52)
marneral synthase (5.4.99.53)
beta-seco-amyrin synthase (5.4.99.54)
delta-amyrin synthase (5.4.99.55)
tirucalladienol synthase (5.4.99.56)
baruol synthase (5.4.99.57)
methylornithine synthase (5.4.99.58)
dTDP-fucopyranose mutase (5.4.99.59)
cobalt-precorrin-8 methylmutase (5.4.99.60)
precorrin-8X methylmutase (5.4.99.61)
D-ribose pyranase (5.4.99.62)
ethylmalonyl-CoA mutase (5.4.99.63)
2-hydroxyisobutanoyl-CoA mutase (5.4.99.64)
pre-alpha-onocerin synthase (5.4.99.65)
alpha-onocerin synthase (5.4.99.66)
4-amino-4-deoxychorismate mutase (5.4.99.67)
Muconate cycloisomerase (5.5.1.1)
3-carboxy-cis,cis-muconate cycloisomerase (5.5.1.2)
Tetrahydroxypteridine cycloisomerase (5.5.1.3)
inositol-3-phosphate synthase (5.5.1.4)
Carboxy-cis,cis-muconate cyclase (5.5.1.5)
chalcone isomerase (5.5.1.6)
nogalonic acid methyl ester cyclase (5.5.1.B6)
Chloromuconate cycloisomerase (5.5.1.7)
clerodienyl diphosphate synthase (5.5.1.B7)
(+)-bornyl diphosphate synthase (5.5.1.8)
Cycloeucalenol cycloisomerase (5.5.1.9)
alpha-pinene-oxide decyclase (5.5.1.10)
dichloromuconate cycloisomerase (5.5.1.11)
copalyl diphosphate synthase (5.5.1.12)
ent-copalyl diphosphate synthase (5.5.1.13)
syn-copalyl-diphosphate synthase (5.5.1.14)
terpentedienyl-diphosphate synthase (5.5.1.15)
halimadienyl-diphosphate synthase (5.5.1.16)
(S)-beta-macrocarpene synthase (5.5.1.17)
lycopene epsilon-cyclase (5.5.1.18)
lycopene beta-cyclase (5.5.1.19)
prosolanapyrone-III cycloisomerase (5.5.1.20)
copal-8-ol diphosphate synthase (5.5.1.21)
(-)-bornyl diphosphate synthase (5.5.1.22)
aklanonic acid methyl ester cyclase (5.5.1.23)
tocopherol cyclase (5.5.1.24)
3,6-anhydro-L-galactonate cycloisomerase (5.5.1.25)
nogalonic acid methyl ester cyclase (5.5.1.26)
D-galactarolactone cycloisomerase (5.5.1.27)
(-)-kolavenyl diphosphate synthase (5.5.1.28)
(+)-kolavenyl diphosphate synthase (5.5.1.29)
labda-7,13-dienyl diphosphate synthase (5.5.1.30)
hapalindole H synthase (5.5.1.31)
12-epi-hapalindole U synthase (5.5.1.32)
12-epi-fischerindole U synthase (5.5.1.33)
(+)-cis,trans-nepetalactol synthase (5.5.1.34)
(+)-cis,cis-nepetalactol synthase (5.5.1.35)
microtubule-severing ATPase (5.6.1.1)
dynein ATPase (5.6.1.2)
plus-end-directed kinesin ATPase (5.6.1.3)
minus-end-directed kinesin ATPase (5.6.1.4)
proteasome ATPase (5.6.1.5)
channel-conductance-controlling ATPase (5.6.1.6)
chaperonin ATPase (5.6.1.7)
myosin ATPase (5.6.1.8)
(R)-2-hydroxyacyl-CoA dehydratase activating ATPase (5.6.1.9)
DNA topoisomerase (5.6.2.1)
DNA 3'-5' helicase (5.6.2.B2)
DNA topoisomerase (ATP-hydrolysing) (5.6.2.2)
DNA 5'-3' helicase (5.6.2.3)
DNA 3'-5' helicase (5.6.2.4)
thiocyanate isomerase (5.99.1.1)
DNA topoisomerase (5.99.1.2)
DNA topoisomerase (ATP-hydrolysing) (5.99.1.3)
2-hydroxychromene-2-carboxylate isomerase (5.99.1.4)
tyrosine-tRNA ligase (6.1.1.1)
tryptophan-tRNA ligase (6.1.1.2)
glutamyl-Q-tRNA(Asp) ligase (6.1.1.B3)
threonine-tRNA ligase (6.1.1.3)
leucine-tRNA ligase (6.1.1.4)
isoleucine-tRNA ligase (6.1.1.5)
lysine-tRNA ligase (6.1.1.6)
alanine-tRNA ligase (6.1.1.7)
D-alanine-sRNA sythetase (6.1.1.8)
valine-tRNA ligase (6.1.1.9)
methionine-tRNA ligase (6.1.1.10)
serine-tRNA ligase (6.1.1.11)
aspartate-tRNA ligase (6.1.1.12)
D-alanine-poly(phosphoribitol) ligase (6.1.1.13)
glycine-tRNA ligase (6.1.1.14)
proline-tRNA ligase (6.1.1.15)
cysteine-tRNA ligase (6.1.1.16)
glutamate-tRNA ligase (6.1.1.17)
glutamine-tRNA ligase (6.1.1.18)
arginine-tRNA ligase (6.1.1.19)
phenylalanine-tRNA ligase (6.1.1.20)
histidine-tRNA ligase (6.1.1.21)
asparagine-tRNA ligase (6.1.1.22)
aspartate-tRNAAsn ligase (6.1.1.23)
glutamate-tRNAGln ligase (6.1.1.24)
lysine-tRNAPyl ligase (6.1.1.25)
pyrrolysine-tRNAPyl ligase (6.1.1.26)
O-phospho-L-serine-tRNA ligase (6.1.1.27)
D-alanine-(R)-lactate ligase (6.1.2.1)
nebramycin 5' synthase (6.1.2.2)
olefin beta-lactone synthetase (6.1.3.1)
acetate-CoA ligase (6.2.1.1)
O-succinylbenzoate-CoA ligase (ADP-forming) (6.2.1.B1)
medium-chain acyl-CoA ligase (6.2.1.2)
long-chain-fatty-acid-CoA ligase (6.2.1.3)
OPC-8:CoA ligase (6.2.1.B3)
glycine:[acyl-carrier protein] ligase (AMP forming) (6.2.1.B4)
succinate-CoA ligase (GDP-forming) (6.2.1.4)
L-alanine:[acyl-carrier protein] ligase (AMP forming) (6.2.1.B5)
succinate-CoA ligase (ADP-forming) (6.2.1.5)
glutarate-CoA ligase (6.2.1.6)
cholate-CoA ligase (6.2.1.7)
oxalate-CoA ligase (6.2.1.8)
malate-CoA ligase (6.2.1.9)
2-(imidazol-4-yl)acetate-CoA ligase (6.2.1.B10)
carboxylic acid-CoA ligase (GDP-forming) (6.2.1.10)
biotin-CoA ligase (6.2.1.11)
carboxylic acid-CoA ligase (NDP-forming) (6.2.1.B11)
4-coumarate-CoA ligase (6.2.1.12)
3-phenylpropionic acid-CoA ligase (6.2.1.B13)
acetate-CoA ligase (ADP-forming) (6.2.1.13)
6-carboxyhexanoate-CoA ligase (6.2.1.14)
arachidonate-CoA ligase (6.2.1.15)
acetoacetate-CoA ligase (6.2.1.16)
propionate-CoA ligase (6.2.1.17)
citrate-CoA ligase (6.2.1.18)
long-chain-fatty-acid-protein ligase (6.2.1.19)
long-chain-fatty-acid-[acyl-carrier-protein] ligase (6.2.1.20)
phenylacetate-CoA ligase (6.2.1.21)
[citrate (pro-3S)-lyase] ligase (6.2.1.22)
dicarboxylate-CoA ligase (6.2.1.23)
phytanate-CoA ligase (6.2.1.24)
benzoate-CoA ligase (6.2.1.25)
O-succinylbenzoate-CoA ligase (6.2.1.26)
4-hydroxybenzoate-CoA ligase (6.2.1.27)
3alpha,7alpha-Dihydroxy-5beta-cholestanate-CoA ligase (6.2.1.28)
3alpha,7alpha,12alpha-trihydroxy-5beta-cholestanate-CoA ligase (6.2.1.29)
phenylacetate-CoA ligase (6.2.1.30)
2-furoate-CoA ligase (6.2.1.31)
anthranilate-CoA ligase (6.2.1.32)
4-chlorobenzoate-CoA ligase (6.2.1.33)
trans-feruloyl-CoA synthase (6.2.1.34)
acetate-[acyl-carrier protein] ligase (6.2.1.35)
3-hydroxypropionyl-CoA synthase (6.2.1.36)
3-hydroxybenzoate-CoA ligase (6.2.1.37)
(2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA synthase (6.2.1.38)
[butirosin acyl-carrier protein]-L-glutamate ligase (6.2.1.39)
4-hydroxybutyrate-CoA ligase (AMP-forming) (6.2.1.40)
3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoate-CoA ligase (6.2.1.41)
3-oxocholest-4-en-26-oate-CoA ligase (6.2.1.42)
2-hydroxy-7-methoxy-5-methyl-1-naphthoate-CoA ligase (6.2.1.43)
3-(methylthio)propionyl-CoA ligase (6.2.1.44)
E1 ubiquitin-activating enzyme (6.2.1.45)
L-allo-isoleucine-holo-[CmaA peptidyl-carrier protein] ligase (6.2.1.46)
medium-chain-fatty-acid-[acyl-carrier-protein] ligase (6.2.1.47)
carnitine-CoA ligase (6.2.1.48)
long-chain fatty acid adenylyltransferase FadD28 (6.2.1.49)
4-hydroxybenzoate adenylyltransferase FadD22 (6.2.1.50)
4-hydroxyphenylalkanoate adenylyltransferase FadD29 (6.2.1.51)
L-firefly luciferin-CoA ligase (6.2.1.52)
L-proline-[L-prolyl-carrier protein] ligase (6.2.1.53)
D-alanine-[D-alanyl-carrier protein] ligase (6.2.1.54)
E1 SAMP-activating enzyme (6.2.1.55)
4-hydroxybutyrate-CoA ligase (ADP-forming) (6.2.1.56)
long-chain fatty acid adenylase/transferase FadD23 (6.2.1.57)
isophthalate-CoA ligase (6.2.1.58)
long-chain fatty acid adenylase/transferase FadD26 (6.2.1.59)
marinolic acid-CoA ligase (6.2.1.60)
salicylate-[aryl-carrier protein] ligase (6.2.1.61)
3,4-dihydroxybenzoate-[aryl-carrier protein] ligase (6.2.1.62)
L-arginine-[L-arginyl-carrier protein] ligase (6.2.1.63)
E1 NEDD8-activating enzyme (6.2.1.64)
salicylate-CoA ligase (6.2.1.65)
glyine---[glycyl-carrier protein] ligase (6.2.1.66)
L-alanine---[L-alanyl-carrier protein] ligase (6.2.1.67)
L-glutamate---[L-glutamyl-carrier protein] ligase (6.2.1.68)
L-cysteine-[L-cysteinyl-carrier protein] ligase (6.2.1.69)
L-threonine-[L-threonyl-carrier protein] ligase (6.2.1.70)
2,3-dihydroxybenzoate-[aryl-carrier protein] ligase (6.2.1.71)
L-serine-[L-seryl-carrier protein] ligase (6.2.1.72)
L-tryptophan-[L-tryptophyl-carrier protein] ligase (6.2.1.73)
3-amino-5-hydroxybenzoate-[acyl-carrier protein] ligase (6.2.1.74)
indoleacetate-CoA ligase (6.2.1.75)
malonate-CoA ligase (6.2.1.76)
thioglycine synthase (6.2.2.1)
oxazoline synthase (6.2.2.2)
thiazoline synthase (6.2.2.3)
aspartate-ammonia ligase (6.3.1.1)
glutamine synthetase (6.3.1.2)
phosphoribosyl-glycinamide synthetase (6.3.1.3)
aspartate-ammonia ligase (ADP-forming) (6.3.1.4)
NAD+ synthase (6.3.1.5)
glutamate-ethylamine ligase (6.3.1.6)
4-methyleneglutamate-ammonia ligase (6.3.1.7)
glutathionylspermidine synthase (6.3.1.8)
trypanothione synthase (6.3.1.9)
adenosylcobinamide-phosphate synthase (6.3.1.10)
glutamate-putrescine ligase (6.3.1.11)
D-aspartate ligase (6.3.1.12)
L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase (6.3.1.13)
diphthine-ammonia ligase (6.3.1.14)
8-demethylnovobiocic acid synthase (6.3.1.15)
carbapenam-3-carboxylate synthetase (6.3.1.16)
beta-citrylglutamate synthase (6.3.1.17)
gamma-glutamylanilide synthase (6.3.1.18)
prokaryotic ubiquitin-like protein ligase (6.3.1.19)
lipoate-protein ligase (6.3.1.20)
phosphoribosylglycinamide formyltransferase 2 (6.3.1.21)
oligomer L-amino acid ligase (6.3.2.B1)
pantoate-beta-alanine ligase (AMP-forming) (6.3.2.1)
glutamate-cysteine ligase (6.3.2.2)
murein peptide ligase (6.3.2.B2)
glutathione synthase (6.3.2.3)
tubulin-glutamate ligase (6.3.2.B3)
D-Alanine-D-alanine ligase (6.3.2.4)
polyglycylase (6.3.2.B4)
phosphopantothenate-cysteine ligase (CTP) (6.3.2.5)
phosphoribosylaminoimidazolesuccinocarboxamide synthase (6.3.2.6)
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-L-lysine ligase (6.3.2.7)
UDP-N-acetylmuramate-L-alanine ligase (6.3.2.8)
UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase (6.3.2.9)
L-asparagine:L-amino acid ligase (6.3.2.B10)
UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase (6.3.2.10)
beta-citrylglutamate synthase (6.3.2.B11)
carnosine synthase (6.3.2.11)
dihydrofolate synthase (6.3.2.12)
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate ligase (6.3.2.13)
enterobactin synthase (6.3.2.14)
3-[[[(2R,3R)-3-carboxyoxiran-2-yl]carbonyl]amino]-L-alanine-L-valine ligase (6.3.2.B15)
UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamino-pimelate-D-alanyl-D-alanine ligase (6.3.2.15)
D-alanine-alanyl-poly(glycerolphosphate) ligase (6.3.2.16)
L-valine-specific L-amino acid ligase (6.3.2.B16)
tetrahydrofolate synthase (6.3.2.17)
gamma-glutamylhistamine synthase (6.3.2.18)
ubiquitin-protein ligase (6.3.2.19)
[LysW]-C-terminal-L-glutamate ligase (6.3.2.B19)
indoleacetate-lysine synthetase (6.3.2.20)
ubiquitin-calmodulin ligase (6.3.2.21)
diphthine-ammonia ligase (6.3.2.22)
3-formyl-tyrosine ligase (6.3.2.B23)
homoglutathione synthase (6.3.2.23)
beta-tubulin-glutamate ligase (6.3.2.B24)
tyrosine-arginine ligase (6.3.2.24)
tubulin-tyrosine ligase (6.3.2.25)
N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (6.3.2.26)
aerobactin synthase (6.3.2.27)
L-amino-acid alpha-ligase (6.3.2.28)
cyanophycin synthase (L-aspartate-adding) (6.3.2.29)
cyanophycin synthase (L-arginine-adding) (6.3.2.30)
coenzyme F420-0:L-glutamate ligase (6.3.2.31)
coenzyme gamma-F420-2:alpha-L-glutamate ligase (6.3.2.32)
tetrahydrosarcinapterin synthase (6.3.2.33)
coenzyme F420-1:gamma-L-glutamate ligase (6.3.2.34)
D-alanine-D-serine ligase (6.3.2.35)
4-phosphopantoate-beta-alanine ligase (6.3.2.36)
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-D-lysine ligase (6.3.2.37)
N2-citryl-N6-acetyl-N6-hydroxylysine synthase (6.3.2.38)
aerobactin synthase (6.3.2.39)
cyclopeptine synthase (6.3.2.40)
N-acetylaspartylglutamate synthase (6.3.2.41)
N-acetylaspartylglutamylglutamate synthase (6.3.2.42)
[amino group carrier protein]-L-2-aminoadipate ligase (6.3.2.43)
pantoate-beta-alanine ligase (ADP-forming) (6.3.2.44)
UDP-N-acetylmuramate-L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptanedioate ligase (6.3.2.45)
fumarate-(S)-2,3-diaminopropanoate ligase (6.3.2.46)
dapdiamide synthase (6.3.2.47)
L-arginine-specific L-amino acid ligase (6.3.2.48)
L-alanine-L-anticapsin ligase (6.3.2.49)
tenuazonic acid synthetase (6.3.2.50)
phosphopantothenate-cysteine ligase (ATP) (6.3.2.51)
jasmonoyl-L-amino acid ligase (6.3.2.52)
UDP-N-acetylmuramoyl-L-alanine-L-glutamate ligase (6.3.2.53)
L-2,3-diaminopropanoate-citrate ligase (6.3.2.54)
2-[(L-alanin-3-ylcarbamoyl)methyl]-3-(2-aminoethylcarbamoyl)-2-hydroxypropanoate synthase (6.3.2.55)
staphyloferrin B synthase (6.3.2.56)
staphyloferrin A synthase (6.3.2.57)
D-ornithine-citrate ligase (6.3.2.58)
3-methyl-D-ornithine---L-lysine ligase (6.3.2.59)
glutamate---[amino group carrier protein] ligase (6.3.2.60)
tubulin-glutamate ligase (6.3.2.61)
beta-tubulin-glutamate ligase (6.3.2.62)
phosphoribosylformylglycinamidine cyclo-ligase (6.3.3.1)
5-formyltetrahydrofolate cyclo-ligase (6.3.3.2)
dethiobiotin synthase (6.3.3.3)
(carboxyethyl)arginine beta-lactam-synthase (6.3.3.4)
O-ureido-D-serine cyclo-ligase (6.3.3.5)
carbapenam-3-carboxylate synthase (6.3.3.6)
Ni-sirohydrochlorin a,c-diamide reductive cyclase (6.3.3.7)
GMP synthase (6.3.4.1)
CTP synthase (glutamine hydrolysing) (6.3.4.2)
formate-tetrahydrofolate ligase (6.3.4.3)
adenylosuccinate synthase (6.3.4.4)
argininosuccinate synthase (6.3.4.5)
urea carboxylase (6.3.4.6)
ribose-5-phosphate-ammonia ligase (6.3.4.7)
imidazoleacetate-phosphoribosyldiphosphate ligase (6.3.4.8)
biotin-[methylmalonyl-CoA-carboxytransferase] ligase (6.3.4.9)
biotin-[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase (6.3.4.10)
biotin-[methylcrotonoyl-CoA-carboxylase] ligase (6.3.4.11)
glutamate-methylamine ligase (6.3.4.12)
phosphoribosylamine-glycine ligase (6.3.4.13)
biotin carboxylase (6.3.4.14)
biotin-[biotin carboxyl-carrier protein] ligase (6.3.4.15)
carbamoyl-phosphate synthase (ammonia) (6.3.4.16)
formate-dihydrofolate ligase (6.3.4.17)
5-(carboxyamino)imidazole ribonucleotide synthase (6.3.4.18)
tRNAIle-lysidine synthase (6.3.4.19)
7-cyano-7-deazaguanine synthase (6.3.4.20)
nicotinate phosphoribosyltransferase (6.3.4.21)
tRNAIle2-agmatinylcytidine synthase (6.3.4.22)
formate-phosphoribosylaminoimidazolecarboxamide ligase (6.3.4.23)
tyramine-L-glutamate ligase (6.3.4.24)
2-amino-2'-deoxyadenylo-succinate synthase (6.3.4.25)
NAD+ synthase (glutamine-hydrolysing) (6.3.5.1)
GMP synthase (glutamine-hydrolysing) (6.3.5.2)
phosphoribosylformylglycinamidine synthase (6.3.5.3)
asparagine synthase (glutamine-hydrolysing) (6.3.5.4)
carbamoyl-phosphate synthase (glutamine-hydrolysing) (6.3.5.5)
asparaginyl-tRNA synthase (glutamine-hydrolysing) (6.3.5.6)
glutaminyl-tRNA synthase (glutamine-hydrolysing) (6.3.5.7)
aminodeoxychorismate synthase (6.3.5.8)
hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing) (6.3.5.9)
adenosylcobyric acid synthase (glutamine-hydrolysing) (6.3.5.10)
cobyrinate a,c-diamide synthase (6.3.5.11)
Ni-sirohydrochlorin a,c-diamide synthase (6.3.5.12)
lipid II isoglutaminyl synthase (glutamine-hydrolysing) (6.3.5.13)
pyruvate carboxylase (6.4.1.1)
acetyl-CoA carboxylase (6.4.1.2)
propionyl-CoA carboxylase (6.4.1.3)
methylcrotonoyl-CoA carboxylase (6.4.1.4)
geranoyl-CoA carboxylase (6.4.1.5)
acetone carboxylase (6.4.1.6)
2-oxoglutarate carboxylase (6.4.1.7)
acetophenone carboxylase (6.4.1.8)
coenzyme F430 synthetase (6.4.1.9)
2'-5' RNA ligase (NTP-independent) (6.5.1.B1)
DNA ligase (ATP) (6.5.1.1)
DNA ligase (NAD+) (6.5.1.2)
2'-5' RNA ligase (GTP-activated) (6.5.1.B3)
RNA ligase (ATP) (6.5.1.3)
RNA 3'-terminal-phosphate cyclase (ATP) (6.5.1.4)
RNA 3'-terminal-phosphate cyclase (GTP) (6.5.1.5)
DNA ligase (ATP or NAD+) (6.5.1.6)
DNA ligase (ATP, ADP or GTP) (6.5.1.7)
3'-phosphate/5'-hydroxy nucleic acid ligase (6.5.1.8)
cyclic 2,3-diphosphoglycerate synthase (6.5.1.9)
magnesium chelatase (6.6.1.1)
cobaltochelatase (6.6.1.2)
3-amino-2-hydroxy-4-methoxybenzoate diazotase (6.7.1.1)
proton-translocating NAD(P)+ transhydrogenase (7.1.1.1)
NADH:ubiquinone reductase (H+-translocating) (7.1.1.2)
ubiquinol oxidase (H+-transporting) (7.1.1.3)
caldariellaquinol oxidase (H+-transporting) (7.1.1.4)
menaquinol oxidase (H+-transporting) (7.1.1.5)
plastoquinol-plastocyanin reductase (7.1.1.6)
quinol oxidase (electrogenic, proton-motive force generating) (7.1.1.7)
quinol-cytochrome-c reductase (7.1.1.8)
cytochrome-c oxidase (7.1.1.9)
ferredoxin---quinone oxidoreductase (H+-translocating) (7.1.1.10)
ferredoxin-NAD+ oxidoreductase (H+-transporting) (7.1.1.11)
succinate dehydrogenase (electrogenic, proton-motive force generating) (7.1.1.12)
P-type H+-exporting transporter (7.1.2.1)
H+-transporting two-sector ATPase (7.1.2.2)
H+-exporting diphosphatase (7.1.3.1)
Na+-exporting diphosphatase (7.1.3.2)
NADH:ubiquinone reductase (Na+-transporting) (7.2.1.1)
ferredoxin-NAD+ oxidoreductase (Na+-transporting) (7.2.1.2)
ascorbate ferrireductase (transmembrane) (7.2.1.3)
Na+-transporting two-sector ATPase (7.2.2.1)
ABC-type Cd2+ transporter (7.2.2.2)
P-type Na+ transporter (7.2.2.3)
ABC-type Na+ transporter (7.2.2.4)
ABC-type Mn2+ transporter (7.2.2.5)
P-type K+ transporter (7.2.2.6)
ABC-type Fe3+ transporter (7.2.2.7)
P-type Cu+ transporter (7.2.2.8)
P-type Cu2+ transporter (7.2.2.9)
P-type Ca2+ transporter (7.2.2.10)
ABC-type Ni2+ transporter (7.2.2.11)
P-type Zn2+ transporter (7.2.2.12)
Na+/K+-exchanging ATPase (7.2.2.13)
P-type Mg2+ transporter (7.2.2.14)
P-type Ag+ transporter (7.2.2.15)
ABC-type ferric hydroxamate transporter (7.2.2.16)
ABC-type ferric enterobactin transporter (7.2.2.17)
ABC-type ferric citrate transporter (7.2.2.18)
H+/K+-exchanging ATPase (7.2.2.19)
ABC-type Zn2+ transporter (7.2.2.20)
Cd2+-exporting ATPase (7.2.2.21)
P-type Mn2+ transporter (7.2.2.22)
carboxybiotin decarboxylase (7.2.4.1)
oxaloacetate decarboxylase (Na+ extruding) (7.2.4.2)
(S)-methylmalonyl-CoA decarboxylase (sodium-transporting) (7.2.4.3)
biotin-dependent malonate decarboxylase (7.2.4.4)
glutaconyl-CoA decarboxylase (7.2.4.5)
ABC-type phosphate transporter (7.3.2.1)
ABC-type phosphonate transporter (7.3.2.2)
ABC-type sulfate transporter (7.3.2.3)
ABC-type nitrate transporter (7.3.2.4)
ABC-type molybdate transporter (7.3.2.5)
ABC-type tungstate transporter (7.3.2.6)
arsenite-transporting ATPase (7.3.2.7)
ABC-type polar-amino-acid transporter (7.4.2.1)
ABC-type nonpolar-amino-acid transporter (7.4.2.2)
mitochondrial protein-transporting ATPase (7.4.2.3)
chloroplast protein-transporting ATPase (7.4.2.4)
bacterial ABC-type protein transporter (7.4.2.5)
ABC-type oligopeptide transporter (7.4.2.6)
ABC-type alpha-factor-pheromone transporter (7.4.2.7)
protein-secreting ATPase (7.4.2.8)
ABC-type dipeptide transporter (7.4.2.9)
ABC-type glutathione transporter (7.4.2.10)
ABC-type methionine transporter (7.4.2.11)
ABC-type cystine transporter (7.4.2.12)
ABC-type tyrosine transporter (7.4.2.13)
ABC-type antigen peptide transporter (7.4.2.14)
ABC-type maltose transporter (7.5.2.1)
ABC-type oligosaccharide transporter (7.5.2.2)
ABC-type beta-glucan transporter (7.5.2.3)
ABC-type teichoic-acid transporter (7.5.2.4)
ABC-type lipopolysaccharide transporter (7.5.2.5)
ABC-type lipid A-core oligosaccharide transporter (7.5.2.6)
ABC-type D-ribose transporter (7.5.2.7)
ABC-type nodulation factor transporter (7.5.2.B7)
ABC-type D-allose transporter (7.5.2.8)
ABC-type D-glucose transporter (7.5.2.B8)
ABC-type alpha-glucoside transporter (7.5.2.B9)
ABC-type D-galactofuranose transporter (7.5.2.9)
ABC-type D-xylose transporter (7.5.2.10)
ABC-type D-galactose transporter (7.5.2.11)
ABC-type L-arabinose transporter (7.5.2.12)
ABC-type D-xylose/L-arabinose transporter (7.5.2.13)
ABC type metal transporter (7.6.2.B1)
P-type phospholipid transporter (7.6.2.1)
ABC-type xenobiotic transporter (7.6.2.2)
ABC-type glutathione-S-conjugate transporter (7.6.2.3)
ABC-type fatty-acyl-CoA transporter (7.6.2.4)
ABC-type heme transporter (7.6.2.5)
ABC-type guanine transporter (7.6.2.6)
ABC-type taurine transporter (7.6.2.7)
ABC-type vitamin B12 transporter (7.6.2.8)
ABC-type quaternary amine transporter (7.6.2.9)
ABC-type glycerol 3-phosphate transporter (7.6.2.10)
ABC-type polyamine transporter (7.6.2.11)
ABC-type capsular-polysaccharide transporter (7.6.2.12)
ABC-type autoinducer-2 transporter (7.6.2.13)
ABC-type aliphatic sulfonate transporter (7.6.2.14)
ABC-type thiamine transporter (7.6.2.15)
ABC-type putrescine transporter (7.6.2.16)
We're sorry, but BRENDA doesn't work properly without JavaScript. Please make sure you have JavaScript enabled in your browser settings.
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
EC Tree
The enzyme appears in viruses and cellular organisms
Reaction Schemes
Similar to pepsin A, but narrower, cleaving only three bonds in the B chain of insulin: Ala14-/-Leu, Tyr16-/-Leu, and Phe24-/-Phe
Synonyms
proteinase ia,
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
carboxyl proteinase I
-
formerly
EC 3.4.23.6
-
-
formerly
-
EC 3.4.4.17
-
-
formerly, part transferred
-
EC 3.4.99.25
-
-
formerly, part transferred
-
Proteinase, Pycnoporus coccineus aspartic
-
-
-
-
Proteinase, Trametes acid
-
-
-
-
Trametes acid proteinase
-
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Similar to pepsin A, but narrower, cleaving only three bonds in the B chain of insulin: Ala14-/-Leu, Tyr16-/-Leu, and Phe24-/-Phe
-
-
-
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
hydrolysis of peptide bond
-
-
aspartic endopeptidase
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O
Asp-Arg-Val-Tyr + Ile-His-Pro-Phe-His-Leu-Leu + Val-Tyr-Ser
-
cleavage of Tyr-Ile and Leu-Val
-
-
?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHLVEA + Leu-Val + LVCGERGF + FYTPKA
-
i.e. oxidized insulin B chain, cleavage site specificity of isozymes Ia and Ib at pH 2.7, overview
-
-
?
Hemoglobin + H2O
?
-
-
-
-
?
Native insulin + H2O
Hydrolyzed insulin
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed
-
?
Oxidized B-chain of insulin + H2O
Hydrolyzed insulin B-chain
-
Ala14-Leu15, Tyr16-Leu17 and Phe24-Phe25 bonds are hydrolyzed primarily
-
?
Oxidized insulin peptide B1-B16 + H2O
?
-
hydrolysis at His10-Leu11 and Ala14-Leu15
-
-
?
pro-angiotensin + H2O
?
-
cleavage at Tyr4-Ile5 and Phe8-Phe9, at pH 2.7
-
-
?
Proangiotensin + H2O
?
-
formerly designated angiotensin I, hydrolysis of Tyr4-Ile5
-
-
?
additional information
?
-
angiotensin + H2O
?
-
cleavage at Tyr4-Ile5, at pH 2.7
-
-
?
angiotensin + H2O
?
-
formerly designated angiotensin II, hydrolysis of Tyr4-Ile5
-
-
?
additional information
?
-
-
the extracellular enzyme is involved in fungal nutrition from wood
-
-
?
additional information
?
-
-
cleavage site specificity of the isoymes, no activity with isulin A chain, overview
-
-
?
additional information
?
-
-
not: oxidized insulin peptide B15-B24, peptide bonds which have a hydrophobic amino acid in the P1' position are preferentially cleaved
-
-
?
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
?
-
-
the extracellular enzyme is involved in fungal nutrition from wood
-
-
?
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
-
purified isozyme Ia and Ib
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
2.3
-
substrate hemoglobin
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
a wood-deteriorating basidiomycete, formerly Trametes sanguinea, isozymes Ia and Ib
-
-
brenda
i.e. Pycnoporus coccineus, Trametes sanguinea
-
-
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
-
crude enzyme preparation
brenda
-
-
brenda
-
submerged culture
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
-
the isozymes are secreted
-
brenda
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
33000 - 34000
-
sedimentation equilibrium centrifugation analysis
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
additional information
-
three-dimensional structure and active site structure
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
purified isozymes Ia and Ib from acetone
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
i.e. Pycnoporus coccineus, Trametes sanguinea
-
native isozymes Ia and Ib 30fold to homogeneity from mycel-free culture filtrate, by acetone precipitation, anion exchange chromatograph, ammonium sulfate fractionation, dialysis and crystallization to homogeneity, and further to puritiy by anion exchange and sulfopropyl chromatograpgy, and isoelectric focusing
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Majima, E.; Oda, K.; Murao, S.; Ichishima, E.
Comparative study on the specificities of several fungal aspartic and acidic proteinases towards the tetradecapeptide of a renin substrate
Agric. Biol. Chem.
52
787-793
1988
Trametes sanguinea
-
brenda
Ichishima, E.; Kumagai, H.; Tomoda, K.
Substrate specificity of carboxyl proteinase from Pycnoporus coccineus, a wood-deteriorating fungus
Curr. Microbiol.
3
333-337
1980
Trametes sanguinea
-
brenda
Ichishima, E.; Emi, M.; Majima, E.; Mayumi, Y.; Kumagai, H.; Hayashi, K.; Tomoda, K.
Initial sites of insulin cleavage and stereospecificity of carboxyl proteinases from Aspergillus sojae and Pycnoporus coccineus
Biochim. Biophys. Acta
700
247-253
1982
Trametes sanguinea
brenda
Kumagai, H.; Matsue, M.; Majima, E.; Tomoda, K.; Ichishima, E.
Carboxyl proteinase from the wood deteriorating basidiomycete Pycnoporus coccineus: substrate specificity with oxidized insulin peptide B1 .apprx. B16 and B15 .apprx. B24, angiotensin and proangiotensin
Agric. Biol. Chem.
45
981-985
1981
Trametes sanguinea
-
brenda
Ichishima, E.
Pycnoporopepsin
Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. )
1
141-143
2004
Trametes coccinea
-
brenda
Select items on the left to see more content.
html completed
3.4.23.30 Pycnoporopepsin
more
top
