print visible entries

print all entries

Show abbreviated version of
the Enzyme Summary Page.

show all entries

Information on EC 3.4.23.29 - Polyporopepsin

for references in articles please use BRENDA:EC3.4.23.29

Word Map on EC 3.4.23.29

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Specify your search results

Mark a special word or phrase in this record:

Search Reference ID:

Search UniProt Accession:

Select one or more organisms in this record:

The expected taxonomic range for this enzyme is: Irpex lacteus

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

3.4.23.29

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

Polyporopepsin

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

Milk clotting activity, broad specificity, but fails to cleave Leu15-Tyr or Tyr16-Leu of insulin B chain

show the reaction diagram

show

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

hydrolysis of peptide bond

-

-

aspartic endopeptidase

-

back to the top

top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

show table

Show Synonyms (9 entries)

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

61573-73-7

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

show

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

Ala-Phe-Gly-Ala + H2O

Ala-Phe + Gly-Ala

show the reaction diagram

-

-

-

-

Ala-Phe-Leu-Ala + H2O

Ala-Phe + Leu-Ala

show the reaction diagram

-

-

-

-

alpha1-casein + H2O

?

show the reaction diagram

-

cleavage of Phe23-Phe24 and Lys103-Tyr104 bonds at pH 6.0

-

-

?

Angiotensin I + H2O

Proteolytically cleaved angiotensin

show the reaction diagram

-

hydrolyzes Tyr4-Ile5 bond much more rapidly than the Val3-Tyr4 bond

-

-

-

beta-casein + H2O

?

show the reaction diagram

-

cleavage of Leu165-Ser166, Ala189-Phe190, and Leu192-Tyr193 bonds, no cleavage of Leu139-Leu140 and Ser142-Trp143 bonds

-

-

?

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O

FVNQHLCGSHL + VEA + LYLVCGERGF + FYT + PKA

show the reaction diagram

-

i.e. insulin B chain, cleavage site specificity at pH 3.0.the Ala14-Leu15 bond is preferred

-

-

?

Gly-Phe-Leu-Ala + H2O

Gly-Phe + Leu-Ala

show the reaction diagram

-

-

-

-

Hemoglobin + H2O

?

show the reaction diagram

-

-

-

-

?

Hemoglobin + H2O

Proteolytically cleaved hemogobin

show the reaction diagram

-

-

-

-

-

kappa-casein + H2O

?

show the reaction diagram

-

cleavage of Phe105-Met106 bond

-

-

?

Oxidized B-chain of insulin + H2O

Proteolytically cleaved insulin B-chain

show the reaction diagram

-

peptide bonds mainly susceptible to the enzyme: Leu11-Val12, Ala14-Leu15, Phe24-Phe25, Thr27-Pro28

-

-

-

Phe-Ala-Ala-Ala + H2O

Phe-Ala + Ala-Ala

show the reaction diagram

-

-

-

-

Phe-Glu-Ala-Ala + H2O

Phe-Glu + Ala-Ala

show the reaction diagram

-

-

-

-

Phe-Gly-Ala-Ala + H2O

Phe-Gly + Ala-Ala

show the reaction diagram

-

-

-

-

Phe-Leu-Ala-Ala + H2O

Phe-Leu + Ala-Ala

show the reaction diagram

-

-

-

-

Phe-Lys-Ala-Ala + H2O

Phe-Lys + Ala-Ala

show the reaction diagram

-

-

-

-

Phe-Tyr-Ala-Ala + H2O

Phe-Tyr + Ala-Ala

show the reaction diagram

-

-

-

-

additional information

?

-

show

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

1,2-epoxy-3-(4-nitrophenoxy)propane

show

chymostatin

-

-

Diazoacetyl-D,L-norleucine methyl ester

show

Diazoacetyl-DL-norleucine methyl ester

-

inactivation, active site-directed inhibitor

Fe3+

-

-

Hg2+

-

-

N-p-toluene sulfonyl-L-Phe chloromethyl ketone

-

-

Pepstatin

show

sodium lauryl sulfate

-

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

additional information

-

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

2.5

-

-

2.8 - 2.9

-

substrates casein and hemoglobin

2.8

-

hemoglobin

3

-

hemoglobin

4

-

Phe-Leu-Ala-Ala

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

5.3

-

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

1wkr, download, 3D-view

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

32000

-

Polyporus tulipiferae, 3U-39, gel filtration

33500

-

Polyporus tulipiferae 2U-148, gel filtration

34000

-

Polyporus tulipiferae KY 2901 and U-212, gel filtration

35000

-

Polyporus tulipiferae, calculation from nucleotide sequence

36000

show

39000

-

1 * 39000, Polyporus tulipiferae, SDS-PAGE

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

?

-

x * 36000, SDS-PAGE

monomer

-

1 * 39000, Polyporus tulipiferae, SDS-PAGE

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

glycoprotein

-

two possible N-glycosylation sites at Asn192 and Asn228, the enzyme shows affinity for concanavalin A, wheat germ agglutinin, and Ricinus communis agglutinin

additional information

-

2 putative N-glycosylation sites, sugar chains can be attached to Asn192 and/or Asn238

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

crystallization by hanging drop method with ammonium sulfate as precipitant, X-ray diffraction structure determination and analysis at 1.9 A resolution

-

enzyme from Fr. KY 2901 and mutant enzymes produced by irradiation with UV-light

-

purified enzyme in complex with inhibitor pepstatin, hanging drop vapour diffusion method, 0.005 ml of 10 mg/ml protein is mixed with 0.005 ml of reservoir solution containing 50% ammonium sulfate in 10 mM sodium citrate-sulfate buffer, pH 5.4, 20°C, X-ray diffraction structure determination and analysis at 1.3 A resolution, structure modeling

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

3 - 6

-

stable

30731

4.6

-

15 min, complete inactivation at 45°C, stable at 30°C

30730

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

30

-

pH 4.6, 15 min, stable

45

-

pH 4.6, 15 min, complete inactivation

50

-

pH 4.5, 15 min, stable up to

60

-

pH 4.5, 15 min, complete inactivation

additional information

-

the enzyme is the least heat-stable among the milk-clotting enzymes

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

-

-

30728, 30730, 30731

native enzyme by dehydroacetylpepstatin affinity chromatography

-

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

-

-

DNA and amino acid sequence determination and analysis

-

back to the top

top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

show table

Show AA Sequence (4 entries)

back to the top

Please wait a moment until the data is sorted. This message will disappear when the data is sorted.

show table

Show References (6 entries)

back to the top

NCBI: PubMed, Protein, Nucleotide, Structure, Genome, OMIM

IUBMB Enzyme Nomenclature

PROSITE Database of protein families and domains

InterPro (database of protein families, domains and functional sites)