Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
5-carboxyfluorescein-Gln-Arg-Val-Arg-Arg-Ala-Val-Gly-Ile-Asp-Lys(5-carboxytetramethylrhodamine)-OH + H2O
?
-
-
-
?
avian influenza virus A hemagglutinin + H2O
?
from strain vian influenza virus, A/chicken/Israel/810/2001 (H9N2), with R-S-K-R cleavage site
-
-
?
factor IX + H2O
?
-
-
-
?
G-protein-coupled receptor GPR107 + H2O
?
IBV spike protein + H2O
?
-
-
-
?
Moloney murine leukemia virus Env precursor protein + H2O
?
PA83 + H2O
?
a protective antigen
-
-
?
PA83 + H2O
PA63 + PA20
the protective antigen substrate is from Bacillus anthracis, commercial plant-produced deglycosylated PA83 (dPA83). Cleavage of the substrate generates two protein fragments with distinctly different molecular masses of 63 kDa (PA63) and 20 kDa (PA20). Plant-produced PA83 protein is almost fully cleaved by commercial furin, while plant-produced truncated enzymatically active furin displays about 75% relative activity compared to commercial human furin in vitro
-
-
?
pGlu-Arg-Thr-Lys-Arg-7-amido-4-methylcoumarin + H2O
pGlu-Arg-Thr-Lys-Arg + 7-amino-4-methylcoumarin
-
-
-
?
phenylacetyl-Arg-Val-Arg-7-amido-4-methylcoumarin + H2O
phenylacetyl-Arg-Val-Arg + 7-amino-4-methylcoumarin
-
-
-
?
pro-bone morphogenetic protein-4 + H2O
mature bone morphogenetic protein-4 + ?
-
-
-
?
pro-Notch1 + H2O
Notch1 + propeptide
-
-
-
?
pro-transforming growth factor-beta1 + H2O
transforming growth factor-beta1 + propeptide
-
-
-
?
proactivin A + H2O
activin A + ?
-
-
-
?
proform tissue growth factor 1beta + H2O
tissue growth factor beta1 + propeptide
-
-
-
?
protein APRIL + H2O
?
commercial substrate preparation
-
-
?
Sema3B + H2O
?
cleavage at the furin recognition site is critical for the function of this tumor suppressor
-
-
?
Sema3C + H2O
?
cleavage at the furin recognition site 742RNRR745. The point mutation R745A at the basic domain at the hypothetical furin recognition site 742RNRR745 disables the processing of Sema3C at this specific location. The C-terminal arginine of the putative furin cleavage site at the basic domain of Sema3C protein is critical for its functions in angiogenesis process
-
-
?
type 1 IGF receptor + H2O
mature type I IDF receptor + ?
-
-
-
?
(2-Aminobenzoyl)-Lys-Glu-Arg-Ser-Lys-Arg-Ser-Ala-Leu-Arg-Asp-(3-nitro)Tyr-Ala + H2O
(2-Aminobenzoyl)-Lys-Glu-Arg-Ser-Lys-Arg + Ser-Ala-Leu-Arg-Asp-(3-nitro)Tyr-Ala
-
-
-
?
2-amino benzoyl-AEQDRNTREVFAQ-T(3-nitro-tyrosine)-A + H2O
2-amino benzoyl-AEQDRNTR + EVFAQ-T(3-nitro-tyrosine)-A
-
furin-mediated cleavage of a fluorogenic peptide derived from hSARS-CoV spike protein
-
-
?
2-aminobenzoyl-Arg-Val-Lys-Arg-Gly-Leu-Ala-Tyr(NO2)-Asp + H2O
?
-
-
-
-
?
Abz-Arg-Val-Lys-Arg-Gly-Leu-Ala-Tyr(NO2)-Asp-OH + H2O
?
-
-
-
-
?
Abz-GIRRKRSVSHQ-EDDnp + H2O
Abz-GIRRKR + SVSHQ-EDDnp
-
-
-
-
?
Abz-GIRRKRSVSHQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-GIRRKR + SVSHQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Rous sarcoma viral envelope glycoprotein
-
-
?
Abz-GRRTRREAIVQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-GRRTRR + EAIVQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Ebola Zaire viral envelope glycoprotein
-
-
?
Abz-HHRQRRSVSIQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-HHRQRR + SVSIQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from human A disintegrin and metalloproteinase with thrombospondin ADAM-TS 6
-
-
?
Abz-HKREKRQAKHQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-HKREKR + QAKHQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from human bone morphogenetic protein hBMP-2
-
-
?
Abz-HRREKRSVALQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-HRREKR + SVALQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Dengue 2 viral envelope glycoprotein
-
-
?
Abz-HRRQKRSVALQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-HRRQKR + SVALQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Dengue 3 viral envelope glycoprotein
-
-
?
Abz-KIRRRRDVVDQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-KIRRRR + DVVDQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Herpes HHV-6A viral envelope glycoprotein
-
-
?
Abz-LKRRRRDTQQQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-LKRRRR + DTQQQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Borna disease viral envelope glycoprotein
-
-
?
Abz-NLRRRRDLVDQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-NLRRRR + DLVDQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Herpes HHV-6B viral envelope glycoprotein
-
-
?
Abz-RERRRKKRGLFGQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RERRRKKR + GLFGQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from a mutation of the H5N1 influenza hemagglutinin processing site
-
-
?
Abz-RKRSRRQVNTQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RKRSRR + QVNTQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Ebola Sudan viral envelope glycoprotein
-
-
?
Abz-RRRAKRSPKHQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RRRAKR + SPKHQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from human bone morphogenetic protein hBMP-4
-
-
?
Abz-RRRDKRSVALQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RRRDKR + SVALQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Dengue 4 viral envelope glycoprotein
-
-
?
Abz-RRRKKRGLFGQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RRRKKR + GLfGQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from the H5N1 influenza hemagglutinin processing site
-
-
?
Abz-RRRKKRGLSGQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RRRKKR + GLSGQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from a mutation of the H5N1 influenza hemagglutinin processing site
-
-
?
Abz-RRRKKRSLFGQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-RRRKKR + SLFGQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from a mutation of the H5N1 influenza hemagglutinin processing site
-
-
?
Abz-RVKRGLAY(NO2)D-OH + H2O
?
-
-
-
-
?
Abz-SGRSRRAIDLQEDDnp + H2O
Abz-SGRSRR + AIDLQEDDnp
-
-
-
-
?
Abz-SKRSRRSVSVQ-EDDnp + H2O
Abz-SKRSRR + SVSVQ-EDDnp
-
-
-
-
?
Abz-SKRSRRSVSVQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-SKRSRR + SVSVQVNTQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Japan beta-encephalitis viral envelope glycoprotein
-
-
?
Abz-SRRHKRFAGVQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-SRRHKR + FAGVQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from measle virus Fo viral envelope glycoprotein
-
-
?
Abz-SRRKRRDVTPQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-SRRKRR + DVTPQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Ebola Ivory Coast viral envelope glycoprotein
-
-
?
Abz-SRRKRRSASTQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-SRRKRR + SASTQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from Herpes HHV-8 viral envelope glycoprotein
-
-
?
Abz-SSRHRRALDTQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-SSRHRR + ALDTQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from human transforming growth factor TGF-beta3
-
-
?
Abz-TRRFRRSITEQ-N-(2,4-dinitrophenyl)ethylenediamine + H2O
Abz-TRRFRR + SITEQ-N-(2,4-dinitrophenyl)ethylenediamine
-
FRET-peptide derived from infectious bronchitis viral envelope glycoprotein
-
-
?
Ac-AAKYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-AAKYKR
-
-
-
?
Ac-AARYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-AARYKR
-
-
-
?
Ac-Arg-Val-Arg-Arg-4-nitroanilide + H2O
Ac-Arg-Val-Arg-Arg + 4-nitroaniline
-
-
-
-
?
Ac-KARYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-KARYKR
-
-
-
?
Ac-norleucine-YKR-4-methylcoumarin-7-amide
acetyl-norleucine-YKR + 7-amino-4-methylcoumarin
-
-
-
-
?
Ac-RA-norvaline-YKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RA-norvaline-YKR
-
-
-
?
Ac-RAKYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RAKYKR
-
-
-
?
Ac-RARYAR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RARYAR
-
-
-
?
Ac-RARYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RARYKR
-
-
-
?
Ac-RARYRR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RARYRR
-
-
-
?
Ac-RYKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RYRR
-
-
-
?
Ac-RYRFKR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Ac-RYRFKR
-
-
-
?
Acetyl-Arg-Glu-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Arg-Lys-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Arg-Phe-Ala-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Arg-Pro-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Arg-Ser-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Lys-Ser-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
acetyl-norleucine-YKR-7-amido-4-methylcoumarin + H2O
acetyl-norleucine-YKR + 7-amino-4-methylcoumarin
-
-
-
-
?
Acetyl-Orn-Ser-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Acetyl-Phe-Ala-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
acetyl-RVRR-4-methylcoumarin 7-amide + H2O
acetyl-RVRR + 7-amino-4-methylcoumarin
-
-
-
-
?
acetyl-RVRR-aminoluciferin + H2O
acetyl-RVRR + D-aminoluciferin
-
the substrate consists of D-aminoluciferin coupled to the C-terminus of furin recognition peptide sequence, furin cleaves at the C-terminal to the last arginine residue. In the presence of furin, the probes are hydrolyzed to remove the peptide caging group and generate free D-aminoluciferin which subsequently produces light emission in the presence of firefly luciferase
-
-
?
acetyl-RYKR-4-methylcoumarin 7-amide + H2O
acetyl-RYKR + 7-amino-4-methylcoumarin
-
-
-
-
?
acetyl-RYKR-aminoluciferin + H2O
acetyl-RYKR + D-aminoluciferin
-
the substrate consists of D-aminoluciferin coupled to the C-terminus of furin recognition peptide sequence, furin cleaves at the C-terminal to the last arginine residue. In the presence of furin, the probes are hydrolyzed to remove the peptide caging group and generate free D-aminoluciferin which subsequently produces light emission in the presence of firefly luciferase
-
-
?
acetyl-Tyr-Glu-Lys-Glu-Arg-Ser-Lys-7-amido-4-methylcoumarin + H2O
acetyl-Tyr-Glu-Lys-Glu-Arg + Ser-Lys-7-amido-4-methylcoumarin
-
-
-
-
?
Acetyl-Tyr-Glu-Lys-Glu-Arg-Ser-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
AcRARYKK-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + AcRARYKK
-
-
-
?
ADAMTS9 propeptide + H2O
?
alpha-Subunit of the rat endopeptidase-24.18 + H2O
?
-
-
-
-
?
anthrax protective antigen precursor + H2O
?
-
-
-
-
?
anthrax protective antigen-83 + H2O
?
-
-
-
-
?
anthrax protective antigen-83 + H2O
anthrax protective antigen-63 + ?
-
-
-
-
?
Boc-RVRR-4-methylcoumarin 7-amide + H2O
Boc-RVRR + 7-amino-4-methylcoumarin
-
-
-
-
?
Boc-RVRR-4-methylcoumarin-7-amide + H2O
7-amino-4-methylcoumarin + Boc-RVRR
-
-
-
?
DSSARIRRNAKG + H2O
DSSARIRR + NAKG
epithelial Na+ channel + H2O
?
-
furin-dependent cleavage of the ectodomain at two sites in the alpha subunit and at a single site within the gamma subunit. Cleavage of the gamma subunit by furin and prostasin is required to release an inhibitory domain
-
-
?
extracellular superoxide dismutase + H2O
?
-
-
-
?
full-length (pro)renin receptor + H2O
soluble (pro)renin receptor + 10 kDa fragment of (pro)renin receptor
Glu-Arg-Thr-Lys-Arg-(7-methylcoumarin-4-yl)acetate + H2O
Glu-Arg-Thr-Lys-Arg + (7-methylcoumarin-4-yl)acetate
-
-
-
-
?
glycoprotein 160 + H2O
?
-
from HIV-1, low activity
-
-
?
gp40/15 + H2O
gp40 + gp15
-
cleaves recombinant Cryptosporidium parvum and Cryptosporidium hominis gp40/15. Putative furin cleavage site RSRR
-
-
?
gp40/15 subtype 1e + H2O
gp40 + gp15
-
RSRR sequence is replaced by ISKR, has an alternative furin cleavage site at KSISKR2
-
-
?
hBMP-2 precursor protein + H2O
?
-
cleavage sites are HKREKR-/-QAKH and HVRISR-/-SLHQ
-
-
?
hBMP-4 precursor protein + H2O
?
-
cleavage sites are RRRAKR-/-SPKH and HVRISR-/-SLPQ
-
-
?
hepatitis B e antigen precursor + H2O
?
-
-
-
-
?
highly pathogenic Queretaro H5N2 hemagglutinin + H2O
?
-
only processed in the presence of heparin
-
-
?
histonin + H2O
?
-
furin releases intact histonin monomers from F4-multimeric histonin (12-mer). Histonin has an RLKR motif at the C-terminus after which furin cleaves specifically
-
-
?
HIV-1 gp160 + H2O
?
-
13mer and 19mer peptides digested equally well by furin at site1, showing complete processing at 5 h. 41mer and 51mer peptides are either barely or unprocessed, respectively. Product inhibition does not explain inability of furin to process the 41mer and 51mer peptides. Extended sequences require heparin for optimal processing
-
-
?
human semaphorin 3F + H2O
?
inactive pro-MT1-MMP + H2O
active MT1-MMP + ?
-
-
-
-
?
influenza deltaK-Fujian-like H5N1 hemagglutinin + H2O
?
-
76% processed
-
-
?
influenza Fujian-like H5N1 hemagglutinin + H2O
?
-
70% processed
-
-
?
influenza variant Fujian-like H5N1 hemagglutinin + H2O
?
-
mutations at the furin-processing site of the hemagglutinin, is less cleaved (38%) by furin as compared to the parent Fujian-like strain derived peptides
-
-
?
membrane type-1 matrix metalloproteinase + H2O
?
-
-
-
-
?
membrane type-1 matrix metalloproteinase proenzyme + H2O
membrane type-1 matrix metalloproteinase + propeptide of membrane type-1 matrix metalloproteinase
membrane-tethered membrane type-1 matrix metallo-proteinase + H2O
?
membrane-type 1-matrix metalloproteinase + H2O
?
-
-
-
-
?
N-benzyloxycarbonyl-RVRR-4-methylcoumarin 7-amide + H2O
N-benzyloxycarbonyl-RVRR + 7-amino-4-methylcoumarin
-
-
-
-
?
N-tert-butoxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
p-Glu-Arg-Thr-Lys-Arg-4-methylcoumaryl-7-amide + H2O
?
-
-
-
?
PA83 + H2O
PA63 + PA20
-
-
-
-
?
PC1/3 C-terminal peptide + H2O
?
-
cleavage by furin into a peptide with an apparent molecular mass of 12.5 kDa. Cleavage of the C-terminal to the pair of Args occupying positions 627 and 628
-
-
?
PC2-S383A
?
-
furin fully processes the PC2 mutant at the secondary site in AtT-20 cells, site is accessible to in trans cleavage
-
-
?
PCSK9 + H2O
?
-
cleavage by furin at Arg218. Mutations R218S, F216L, and D374Y of PCSK9 associated with hypercholesterolemia result in total or partial loss of furin/PC5/6A processing at the motif RFHR21, mutant A443T shows enhanced susceptibility to furin cleavage
-
-
?
pGlu-Arg-Thr-Lys-4-methylcoumarin 7-amide + H2O
pGlu-Arg-Thr-Lys + 7-amino-4-methylcoumarin
-
-
-
-
?
pGlu-Arg-Thr-Lys-Arg-(7-methylcoumarin-4-yl)acetate + H2O
?
-
-
-
-
?
pGlu-Arg-Thr-Lys-Arg-4-methylcoumarin 7-amide + H2O
pGlu-Arg-Thr-Lys-Arg + 7-amino-4-methylcoumarin
-
-
-
-
?
pGlu-Arg-Thr-Lys-Arg-4-methylcoumaryl-7-amide + H2O
?
-
-
-
-
?
pGlu-Arg-Thr-Lys-Arg-4-methylcoumaryl-7-amide + H2O
pGlu-Arg-Thr-Lys-Arg + 7-amino-4-methylcoumarin
-
-
-
-
?
POMC prohormone precursor + H2O
ACTH + alpha-MSH + beta-endorphin
-
human pituitary may utilize the cathepsin L and prohormone convertase pathways for producing POMC-derived peptide hormones
-
-
?
pro-ADAMTS4 + H2O
?
-
furin plays an important role in the intracellular removal of ADAMTS4 prodomain. Multiple furin recognition sites: 206RPRR209, 209RAKR212, or 211KR212
-
-
?
pro-B-type natriuretic peptide + H2O
B-type natriuretic peptide + pro-peptide of B-type natriuretic peptide
pro-CD109 + H2O
CD109 + CD109 propeptide
pro-hADAM-15 protein + H2O
?
-
cleavage site is HIRRRR-/-DVVT
-
-
?
pro-hADAM-TS 4 protein + H2O
?
-
cleavage site is RPRRAKR-/-FASL
-
-
?
pro-hADAM-TS 6 protein + H2O
?
-
cleavage site is HHRQRR-/-SVSI
-
-
?
pro-hADAMTS-17 protein + H2O
?
-
cleavage site is HVRKRR-/-ADPD
-
-
?
pro-hADAMTS-23 protein + H2O
?
-
cleavage site is LKRRKR-/-AVNP
-
-
?
pro-hepcidin + H2O
active mature hepcidin
-
furin processes the iron-regulatory peptide hepcidin to the bioactive mature hepcidin-25 form
-
-
?
pro-hTGF-best1 protein + H2O
?
-
-
-
-
?
pro-hTGF-beta1 protein + H2O
?
-
cleavage site is NRRKKR-/-ALDA
-
-
?
pro-hTGF-beta2 protein + H2O
?
-
cleavage site is GQRKKR-/-ALDT
-
-
?
pro-hTGF-beta3 protein + H2O
?
-
cleavage site is SSRHRR-/-ALDT
-
-
?
pro-hTGF-beta4 protein + H2O
?
-
cleavage site is RSRGRR-/-FSQS
-
-
?
pro-MT-MMP 1 protein + H2O
?
-
cleavage site is NVRRKR-/-YALT
-
-
?
pro-MT-MMP 11 protein + H2O
?
-
cleavage site is RHRQKR-/-FVLS
-
-
?
pro-MT-MMP 3 protein + H2O
?
-
cleavage site is RNRQKR-/-FVLS
-
-
?
pro-MT-MMP 4 protein + H2O
?
-
cleavage site is QSRRRR-/-QTPP
-
-
?
pro-MT-MMP 6 protein + H2O
?
-
cleavage site is VRRRRR-/-YALS
-
-
?
pro-von Willebrand factor + H2O
?
-
-
-
-
?
proaerolysin + H2O
?
-
cleavage site is KVRRAR-/-SVDG
-
-
?
procollagen V + H2O
?
-
proteolytic processing of the proalpha1(V) C-propeptide chain. Proteolytic C-propeptide removal by furin occurs between Arg1585 and Asn1586. Processing of the C-propeptide by furin is more efficient than processing by bone morphogenetic protein-1
-
-
?
proPDGF-A + H2O
PDGF-A + PGDF-A propeptide
-
a growth factor proform
-
-
?
proPDGF-B + H2O
PDGF-B + PGDF-B propeptide
-
a growth factor proform of 31 kDa
mature form of 17 kDa
-
?
Protective antigen component of anthrax toxin + H2O
?
-
cleavage at the sequence Arg-Lys-Lys-Arg
-
-
?
Protein precursor + H2O
?
proVEGF-C + H2O
VEGF-C + VEGF-C propeptide
-
a growth factor proform
-
-
?
Pseudomonas exotoxin A + H2O
?
-
-
-
-
?
Pseudomonas toxin + H2O
?
-
cleavage site is RHRQPR-/-GWEQ
-
-
?
Pyr-Arg-Thr-Lys-Arg-4-methylcoumarin 7-amide + H2O
?
-
-
-
-
?
Pyr-Arg-Thr-Lys-Arg-4-methylcoumaryl-7-amide + H2O
7-amino-4-methylcoumarin + Pyr-Arg-Thr-Lys-Arg
-
pERTKR-MCA
-
?
Pyr-Arg-Thr-Lys-Arg-4-methylcoumaryl-7-amide + H2O
?
-
-
-
-
?
pyroglutamic acid-Arg-Thr-Lys-Arg-7-amido-4-methylcoumarin + H2O
?
-
-
-
-
?
pyroglutamic acid-Arg-Thr-Lys-Arg-methylcoumaryl-7-amide + H2O
?
-
-
-
-
?
pyroglutamic acid-RTKR-4-methylcoumarin 7-amide + H2O
pyroglutamic acid-RTKR + 7-amino-4-methylcoumarin
-
-
-
-
?
RPTPkappa + H2O
?
-
furin is required for S1 processing of RPTPkappa in the secretory pathway. Purified furin cleaves RPTPkappa within the membrane-proximal fibronectin type III domain at the sequence RTKR
-
-
?
SARS coronavirus spike glycoprotein + H2O
?
-
introduction of a prototypic furin recognition motif at R667 allows for efficient cleavage of the mutant glycoprotein
-
-
?
t-butoxycarbonyl-Arg-Val-Arg-Arg-7-amido-4-methylcoumarin + H2O
?
-
-
-
?
t-butyloxycarbonyl-Arg-Val-Arg-Arg-7-amido-4-methylcoumarin + H2O
?
-
-
-
-
?
tert-butoxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumarin 7-amide + H2O
tert-butoxycarbonyl-Arg-Val-Arg-Arg + 7-amino-4-methylcoumarin
-
-
-
-
?
tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide + H2O
tert-butyloxycarbonyl-Arg-Val-Arg-Arg + 7-amino-4-methylcoumarin
-
-
-
-
?
tert-butyloxycarbonyl-RVRR-4-methylcoumaryl-7-amide + H2O
?
-
-
-
-
?
Viral spike glycoproteins + H2O
?
-
-
-
-
?
additional information
?
-
G-protein-coupled receptor GPR107 + H2O
?
cleavage by endoprotease furin, a disulfide bond connects the two resulting fragments, overview
-
-
?
G-protein-coupled receptor GPR107 + H2O
?
recombinant HA-tagged substrate expressed in HeLa cells. GPR107 contains an extended furin recognition site that includes KSKR, a variant of the classical furin cleavage motif (Arg-Xaa-(Lys/Arg)-Arg), although not common among furin substrates, in GPR107 the Lys residue replaces the first conserved Arg
-
-
?
Moloney murine leukemia virus Env precursor protein + H2O
?
-
-
-
?
Moloney murine leukemia virus Env precursor protein + H2O
?
furin cleaves the Env precursor into the surface and transmembrane subunits in the cell and then the viral protease cleaves the R-peptide from TM in newvirus. Structure analysis of the open cage-like structure like that of the R-peptide precursor and of the mature protein, overview. Furin cleavage not only separates the subunits and liberates the fusion peptide at the end of TM but also allows the C-terminal domain to relocate into a peripheral position. This conformational change might explain how the C-terminal domain of surface subunit gains the potential to undergo disulfide isomerization, an event that facilitates membrane fusion
-
-
?
ADAMTS9 propeptide + H2O
?
-
the intact zymogen is secreted to the cell surface and is subsequently processed by furin before release into thge medium. ADAMTS9 processing is exclusively extracellular and occurs at the cell surface in cells that express high levels of furin
-
-
?
ADAMTS9 propeptide + H2O
?
-
ADAMTS is a disintegrin and metalloprotease domain with thrombospondin type 1 repeats
-
-
?
DSSARIRRNAKG + H2O
DSSARIRR + NAKG
-
peptide derived bone morphogenetic protein BMP10, cleavage occurs at residue R316
-
-
?
DSSARIRRNAKG + H2O
DSSARIRR + NAKG
-
peptide-derived bone morphogenetic protein BMP10, cleavage occurs at residue R316
-
-
?
full-length (pro)renin receptor + H2O
soluble (pro)renin receptor + 10 kDa fragment of (pro)renin receptor
-
i.e. (P)RR, cleavage site at Arg275-X-X-Arg278-/-, no activity with (P)RR mutant R275A/KT/R278A. The soluble form of the (pro)renin receptor generated through intracellular cleavage by furin is secreted in plasma
i.e. s(P)RR, a 28 kDa protein
-
?
full-length (pro)renin receptor + H2O
soluble (pro)renin receptor + 10 kDa fragment of (pro)renin receptor
-
i.e. (P)RR, a 35 kDa protein, cleavage site at Arg275-X-X-Arg278-/-, no activity with (P)RR mutant R275A/KT/R278A
i.e. s(P)RR, a 28 kDa protein
-
?
hemagglutinin + H2O
?
-
-
-
-
?
hemagglutinin + H2O
?
-
from avian influenza H5N1 virus, high activity
-
-
?
human semaphorin 3F + H2O
?
-
furin processing of semaphorin 3F determines its anti-angiogenic activity by regulating direct binding and competition for neuropilin, overview
-
-
?
human semaphorin 3F + H2O
?
-
the substrate is produced as a C-terminal or an N-terminal human growth hormone fusion from the pLexM vector. Cleavage at the RXRR furin recognition site in the C-terminus, which is essential for the interaction of the C-terminus of Sema3F with the b1 domain of neuropilin
-
-
?
membrane type-1 matrix metalloproteinase proenzyme + H2O
membrane type-1 matrix metalloproteinase + propeptide of membrane type-1 matrix metalloproteinase
-
-
-
-
?
membrane type-1 matrix metalloproteinase proenzyme + H2O
membrane type-1 matrix metalloproteinase + propeptide of membrane type-1 matrix metalloproteinase
-
intracellular processing in breast carcinoma MCF-MT1-E240A-FLAG cells
-
-
?
membrane-tethered membrane type-1 matrix metallo-proteinase + H2O
?
-
furin regulates the intracellular activation and the uptake rate of cell surface-associated MT1-MMP at the surface of cancer cells. Furin and related PCs are the essential components of the specialized cellular machinery that controls the levels of the functionally active, mature, MT1-MMP enzyme on the cell surface to continually support the potency of pericellular proteolysis
-
-
?
membrane-tethered membrane type-1 matrix metallo-proteinase + H2O
?
-
there are two furin cleavage motifs, R89-R-P-R-C93 and R108-R-K-R-Y112
-
-
?
pro-B-type natriuretic peptide + H2O
B-type natriuretic peptide + pro-peptide of B-type natriuretic peptide
-
activation by N-terminal fragment cleavage of proBNP in human plasma through furin
-
-
?
pro-B-type natriuretic peptide + H2O
B-type natriuretic peptide + pro-peptide of B-type natriuretic peptide
-
cleavage sequence is Arg73-Ala-Pro-Arg76-/-Ser77
-
-
?
pro-CD109 + H2O
CD109 + CD109 propeptide
-
CD109 is produced as a 205 kDa glycoprotein, which is then processed in the Golgi apparatus into 180 kDa and 25 kDa proteins by furin
-
-
?
pro-CD109 + H2O
CD109 + CD109 propeptide
-
CD109 is a glycosylphosphatidylinositol-anchored glycoprotein, cleavage motif comprises amino acids 1270-RRRR-1273
-
-
?
Protein precursor + H2O
?
-
Sindbis virus gpE2
-
-
?
Protein precursor + H2O
?
-
cleavage of-Arg-Xaa-Yaa-Arg-+- bonds where Xaa can be any amino acid and Yaa is Arg or Lys
-
-
?
Protein precursor + H2O
?
-
human complement pro-C3
-
-
?
Protein precursor + H2O
?
-
fowl plague virus hemagglutinin
-
-
?
Protein precursor + H2O
?
-
Newcastle disease virus glycoprotein F0
-
-
?
Protein precursor + H2O
?
-
human insulin pro-receptor
-
-
?
Protein precursor + H2O
?
-
human immunodeficiency virus glycoprotein 160
-
-
?
Protein precursor + H2O
?
-
pro-von Willebrand factor (both the P4 arginine and the P2 lysine play an important role in substrate recognition)
-
-
?
Protein precursor + H2O
?
-
measles glycoprotein F0
-
-
?
Protein precursor + H2O
?
-
human cytomegalovirus glycoprotein B
-
-
?
Protein precursor + H2O
?
-
the term -+- depicts the point of cleavage, e.g. stromelysin 3
-
-
?
Protein precursor + H2O
?
-
proalbumin (human)
-
-
?
Shiga toxin + H2O
?
-
not only the sequence known to be a minimal furin-recognition site, but also the structure around this site are important for furin processing of Shiga toxin and for rapid intoxication
-
-
?
Shiga toxin + H2O
?
-
cleavage site is ASRVAR-/-MASD
-
-
?
additional information
?
-
activation mechanism of avian influenza virus H9N2 by furin, overview. Israel810 HA can be cleaved in cells with high levels of furin expression, a mutation that eliminates a glycosylation site in HA1 allows the Israel810 hemagglutinin to gain universal cleavage in cell culture. Influenza virus HA is a complex protein, folded in a tertiary structure. In this situation, accessibility of the cleavage site to proteases becomes as important as the primary sequence itself
-
-
?
additional information
?
-
-
activation mechanism of avian influenza virus H9N2 by furin, overview. Israel810 HA can be cleaved in cells with high levels of furin expression, a mutation that eliminates a glycosylation site in HA1 allows the Israel810 hemagglutinin to gain universal cleavage in cell culture. Influenza virus HA is a complex protein, folded in a tertiary structure. In this situation, accessibility of the cleavage site to proteases becomes as important as the primary sequence itself
-
-
?
additional information
?
-
proprotein convertases represent highly selective serine proteases that activate their substrates upon proteolytic cleavage
-
-
?
additional information
?
-
-
proprotein convertases represent highly selective serine proteases that activate their substrates upon proteolytic cleavage
-
-
?
additional information
?
-
high substrate selectivity and enzymatic activity of furin
-
-
?
additional information
?
-
recombinant expression of Sema3 wild-type substrates and of mutant Sema3C (R745A, 85.2 kDa) in HEK-293FT cells
-
-
?
additional information
?
-
-
recombinant expression of Sema3 wild-type substrates and of mutant Sema3C (R745A, 85.2 kDa) in HEK-293FT cells
-
-
?
additional information
?
-
to transiently express the substrate factor IX (FIX, amino acids 29-461) in Nicotiana benthamiana plants, the signal peptide (amino acids 1-28) is removed from the FIX sequence (UniProt ID P00740) and replaced with a Nicotiana tabacum PR-1a signal peptide. a KDEL sequence and the His6 tag are added to the C-terminus. Enzyme substrate precursor polypeptide of factor IX (FIX) undergoes several post translational modifications (PTMs), including the removal of the signal peptide (aa 1-28), carboxylation of the first 12 glutamic acid residues downstream from the 18-amino acid propeptide sequence (aa 29-46) in the region rich in glutamic acid (aa 47-92, called the gamma-carboxyglutamic acid or Gla domain) at the N-terminus. Proper gamma-carboxylation of the Gla domain is required for binding to calcium and phospholipids that is critical for proper protease activity during coagulation. In vivo, vitamin K-dependent gamma-carboxylase binds to the 18-amino acid propeptide of FIX, which is then cleaved and is required for optimal binding of the Gla domain to Ca2+ and phospholipids
-
-
?
additional information
?
-
-
to transiently express the substrate factor IX (FIX, amino acids 29-461) in Nicotiana benthamiana plants, the signal peptide (amino acids 1-28) is removed from the FIX sequence (UniProt ID P00740) and replaced with a Nicotiana tabacum PR-1a signal peptide. a KDEL sequence and the His6 tag are added to the C-terminus. Enzyme substrate precursor polypeptide of factor IX (FIX) undergoes several post translational modifications (PTMs), including the removal of the signal peptide (aa 1-28), carboxylation of the first 12 glutamic acid residues downstream from the 18-amino acid propeptide sequence (aa 29-46) in the region rich in glutamic acid (aa 47-92, called the gamma-carboxyglutamic acid or Gla domain) at the N-terminus. Proper gamma-carboxylation of the Gla domain is required for binding to calcium and phospholipids that is critical for proper protease activity during coagulation. In vivo, vitamin K-dependent gamma-carboxylase binds to the 18-amino acid propeptide of FIX, which is then cleaved and is required for optimal binding of the Gla domain to Ca2+ and phospholipids
-
-
?
additional information
?
-
-
no processing of: human lactase-phlorizin hydrolase
-
-
?
additional information
?
-
-
Preference for Arg-Glu-Lys-Arg-+-Ala vs. Lys-Ala-Lys-Arg-+-Arg
-
-
?
additional information
?
-
-
peptides patterned on the sequence 307-330 of the specific viral strains of the gp120 V3 loop
-
-
?
additional information
?
-
-
study of the specificity of human prohormone convertase PC1 and human furin
-
-
?
additional information
?
-
-
viruses can be activated by furin
-
-
?
additional information
?
-
-
endoproteolytic cleavage at paired basic residues of proproteins of the eukaryotic secretory pathway
-
-
?
additional information
?
-
-
probably involved in the proteolysis resulting in secretion of rat endopeptidase 24.18 alpha-subunit
-
-
?
additional information
?
-
-
possible role in processing essential cellular factors
-
-
?
additional information
?
-
-
processing of viral glycoproteins
-
-
?
additional information
?
-
-
implicated in maturation of substrates involved in development, signaling, coagulation, and pathogenesis, constitutive secretory pathway
-
?
additional information
?
-
-
proteolytic processing of a variety of proteins in the exocytic and endocytic pathways
-
?
additional information
?
-
-
is not able to cleave mutant Shiga-2D toxin
-
-
?
additional information
?
-
-
low pathogenic Mexico H5N2 hemagglutinin is not processed by furin
-
-
?
additional information
?
-
-
mutation in the RSRR cleavage site prevents processing of gp40/15
-
-
?
additional information
?
-
-
a three-step autocatalytic processing including the cleavage of the prodomain at the Arg-Leu-Gln-Arg89Q-Glu90 site, is required for the efficient activation of furin
-
-
?
additional information
?
-
-
furin possesses a strong preference for substrates containing the multibasic cleavage motif Arg-X-Arg/Lys-ArgV-X
-
-
?
additional information
?
-
-
the bioluminescence emission in the presence of firefly luciferase, recombinantly expressed as GFP-tagged enzyme in human MDA-MB-468 cells, breast adenocarcinoma cells, is furin-dependent and specific
-
-
?
additional information
?
-
-
furin cleavage sequence is RXXR-/-X, X is not Cys
-
-
?
additional information
?
-
-
furin is a proprotein convertase that requires the cleavage sequence R-X-K/R-R, clear interdependence of furin subsites, substrate specificity with synthetic peptide substrates, overview
-
-
?
additional information
?
-
-
furin performs a calcium-dependent proteolytic cleavage at the C-terminus of a consensus amino acid motif R-X-K/R-R, with X being any amino acid. This tetrapeptide motif provides sufficient specificity to bind the active furin
-
-
?
additional information
?
-
-
furin performs autocleaqvage to its soluble form
-
-
?
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
(1S,14S,17S,20S,23S,26S,33r)-26-amino-N-(4-carbamimidoylbenzyl)-20,23-bis(3-guanidinopropyl)-17-neopentyl-4,8,16,19,22,25,32-heptaoxo-3,9,15,18,21,24,31-heptaazabicyclo[31.2.2]heptatriacontane-14-carboxamide
-
1,1'-((1R,3S,4S,6R)-4,6-bis(4-guanidinophenoxy)cyclohexane-1,3-diyl)diguanidine
meso compound
1,1'-((1R,3S,4S,6R)-4-((4-guanidinonaphthalen-1-yl)oxy)-6-(4-guanidinophenoxy)cyclohexane-1,3-diyl)diguanidine
racemate, blocks the S2 pocket
1,1'-((1S,3R,4R,6S)-4-((4-guanidinonaphthalen-1-yl)oxy)-6-(4-guanidinophenoxy)cyclohexane-1,3-diyl)diguanidine
blocks the S2 pocket
3-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(4-amidomethyl)-benzamidine
MI-52, a substrate-analogous, noncovalent inhibitor. The furin-MI-52 complex is highly stable
3-guanidinomethylphenylacetyl-Val-Arg 4-amidinobenzylamide
-
4-aminomethyl-phenylacetyl-Arg-Tle-Arg-4-aminomethyl-benzamidine
-
Ac-Ac-RQIKIWFQNRRMKWKKRVR 4-amidinobenzylamide
-
Ac-AGYLLGKINLKALAALAKKILRVR 4-amidinobenzylamide
-
Ac-RRRRRRRVR 4-amidinobenzylamide
-
Ac-YGRKKRRQRRRVR 4-amidinobenzylamide
-
acetyl-Val-Arg-4-aminomethyl-benzamidine
-
alpha1-antitrypsin M352R
i.e. alpha1-PDX. Engineering of alpha1-antitrypsin variants, containing Arg at the P1 site within the reactive site loop, with improved specificity for the proprotein convertase furin using site-directed random mutagenesis, screening, overview. The engineered a1-antitrypsin variant carrying the RXXR consensus motif for furin within its reactive site loop. Furin-mediated maturation of bone morphogenetic protein-4 is completely inhibited by ectopic expression of the AVNR variant
-
Arg-Arg-Arg-Arg-Arg-Arg
-
Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg
-
Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg
-
Arg-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
Arg-Arg-Arg-Val-Arg-4-amidinobenzylamide
-
Arg-Arg-Arg-Val-Arg-4-aminomethyl-benzamidine
-
Arg-Arg-Val-Arg 4-amidinobenzylamide
-
cyclo[glutaryl-Arg-Arg-Arg-Lys]-Arg 4-amidinobenzylamide
-
cyclo[glutaryl-Arg-Arg-Lys]-Arg 4-amidinobenzylamide
-
cyclo[glutaryl-Arg-Arg-Lys]-Lys 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Arg-Arg-Lys]-Arg 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Arg-Arg-Lys]-Lys 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Arg-Lys]-Arg 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Arg-Lys]-Lys 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Lys]-Arg 4-amidinobenzylamide
-
cyclo[succinyl-Phe-2-Nal-Arg-Arg-Arg-Lys]-Lys 4-amidinobenzylamide
-
D-Arg-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
D-Arg-Arg-Tle-Arg 4-amidinobenzylamide
-
D-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
D-Arg-D-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
D-Arg-D-Arg-D-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
D-Arg-D-Arg-D-Arg-D-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
decanoyl-RVKR-chloromethylketone
-
Lys-Arg-Arg-Tle-Lys 4-amidinobenzylamide (Lys1-Lys5 4-[4-(2-amino-2-oxoethyl)piperazin-1-yl]butanamide bridged)
-
Lys-Arg-Arg-Tle-Lys 4-amidinobenzylamide (Lys1-Lys5 N1-[[4-(2-amino-2-oxoethyl)phenyl]methyl]butanediamide bridged)
-
Lys-Arg-Arg-Tle-Lys 4-amidinobenzylamide (Lys1-Lys5 N1-[[4-(2-amino-2-oxoethyl)phenyl]methyl]pentanediamide bridged)
-
m-guanidinomethyl-phenylacetyl-Arg-Val-Arg-(amidomethyl)-benzamidine
a competitive, noncovalent inhibitor, binding structure, overview
N,N'-[[(1R,3S,4S,6R)-4-carbamimidamido-6-(4-carbamimidamidoanilino)cyclohexane-1,3-diyl]bis(oxy-4,1-phenylene)]diguanidine
racemate, interferes directly with the catalytic competent conformation of the catalytic triad. Inhibition mechanism, overview
N,N'-[[(1S,3R,4R,6S)-4-carbamimidamido-6-(4-carbamimidamidoanilino)cyclohexane-1,3-diyl]bis(oxy-4,1-phenylene)]diguanidine
interferes directly with the catalytic competent conformation of the catalytic triad. Inhibition mechanism, overview
N2(carbamidoyl)Arg-Ala-Arg-Val-Arg 4-amidinobenzylamide
-
N2(carbamidoyl)Arg-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
N2-(3-aminomethyl-phenylacetyl)-Val-Arg 4-amidinobenzylamide
-
N2-(5-(guanidino)valeroyl)-Val-Arg 4-amidinobenzylamide
-
N2-(5-aminopentanoyl)-Val-Arg 4-amidinobenzylamide
-
N2-(5-guanidinopentanoly)-Val-Arg 4-amidinobenzylamide
-
N2-acetyl-D-Leu-Leu-Leu-Leu-Arg-Val-Lys 4-amidinobenzylamide
-
N2-acetyl-Leu-Leu-Leu-Leu-Arg-Tle-Arg 4-amidinobenzylamide
-
N2-acetyl-Leu-Leu-Leu-Leu-Arg-Tle-Lys 4-amidinobenzylamide
-
N2-acetyl-Leu-Leu-Leu-Leu-Arg-Val-Arg 4-amidinobenzylamide
-
N2-acetyl-Leu-Leu-Leu-Leu-Arg-Val-Lys 4-amidinobenzylamide
-
N2-phenylacetyl-Ala-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
N2-phenylacetyl-Arg-Ala-Arg-Val-Arg 4-amidinobenzylamide
-
N2-phenylacetyl-Arg-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
N2-phenylacetyl-Arg-Arg-Val-Arg 4-amidinobenzylamide
-
N2-phenylacetyl-Arg-Val-Arg 4-amidinobenzylamide
-
Nalpha(carbamidoyl)Arg-Arg-Val-Arg 4-amidinobenzylamide
-
phenylacetyl-Arg-Val-Arg-(amidomethyl)-benzamidine
a competitive, noncovalent inhibitor, binding structure, overview
phenylacetyl-Arg-Val-Arg-4-aminomethyl-benzamidine
-
phenylacetyl-Cit-Arg-Val-Arg-4-aminomethyl-benzamidine
-
(D-Arg)9-amide
-
protects RAW264.7 cells against anthrax toxemia with an IC50 of 0.0037 mM
(E)-N-((E)-5-(2-chloro-5-nitrobenzylidene)-4-oxothiazolidin-2-ylidene)-4-methylbenzenesulfonamide
-
competitive inhibitor
(N'Z,N''Z)-4,4'-oxybis(N'-(2-hydroxybenzylidene)benzenesulfonohydrazide)
-
competitive inhibitor
1,2,12,13-tetradehydro-3,4,10,11-tetrahydro-5,9-(azeno)-4,10-benzodiazacyclopentadecine
-
12% inhibition at 0.1 mM
1,2,12,13-tetradehydro-3,4,10,11-tetrahydro-5,9-(metheno)-4,10-benzodiazacyclopentadecine
-
10% inhibition at 0.1 mM
11-amino-undecanoyl-RARRRKKRT
-
-
2-(11-hydroxy-3-oxo-3H-dibenzo[c,h]xanthen-7-yl)benzoic acid
-
noncompetitive inhibitor
3'-oxo-6a,14a-dihydro-3'H-spiro[dibenzo[c,h]xanthene-7,1'-isobenzofuran]-3,11-diyl diacetate
-
-
3,3',3'',3'''-(1,4-phenylenebis(methanetriyl))tetrakis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-((2,3-dihydro-1H-inden-5-yl)methylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-((2-bromophenyl)methylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-((2-chlorophenyl)methylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-((3,4,5-trimethoxyphenyl)methylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-((4-isopropoxyphenyl)methylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-(benzo[d][1,3]dioxol-5-ylmethylene)bis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3,3'-methylenebis(4-hydroxy-2H-chromen-2-one)
-
noncompetitive inhibitor
3-(alpha-acetonyl-benzyl)-4-(hydroxycoumarin)
-
-
3-allyl-1-methyl-1,2,3,4-tetrahydroisoquinoline
-
competitive inhibitor
3-hydroxy-5-(4-methoxyphenyl)-2-(4-phenoxy-3-sulfophenyl)-3H-pyrazol-2-ium
-
competitive inhibitor
4,10-bis[(4-methylphenyl)sulfonyl]-1,2,12,13-tetradehydro-3,4,10,11-tetrahydro-5,9-(metheno)-4,10-benzodiazacyclopentadecine
-
-
4,6-bis(4-guanidinylphenoxy)-1-guanidinyl-3-(4-guanidinylphenylamino)cyclohexane
-
-
4,7-dibenzyl-1,2,9,10-tetradehydro-3,4,5,6,7,8-hexahydro-4,7-benzodiazacyclododecine
-
-
4-hydroxy-3-oxo-1-phenylbutylcoumarin
-
-
6-oxo-6H-benzo[c]chromen-3-yl 2-chlorobenzoate
-
-
8,11,22,25-tetrabenzyl-5,6,13,14,19,20,27,28-octadehydro-7,8,9,10,11,12,21,22,23,24,25,26-dodecahydrodibenzo[h,t][1,4,13,16]tetraazacyclotetracosine
-
-
8-amino-octanoyl-RARRRKKRT
-
-
alpha1-Aantichymotrypsin
-
incorporation of furin recognition sequences within the reactive site loop of alpha1-antiprypsin leads to the production of furin inhibitors, construction of a series of alpha1-antichymotrypsin mutants by modifying the P7-P1 region of the reactive site loop
-
alpha1-antitrypsin Portland variant
-
i.e. alpha1-PDX, inhibits furin and the generation of soluble (pro)renin receptor
-
alpha1-PDX inhibitor
-
-
-
beta-Ala-TPRARRRKKRT-amide
-
-
brefeldin A
-
blocks the tumor necrosis factor alpha-induced activation of furin and subsequent neutral sphingomyelinase activation, without altering the basal level of furin
Cu(2,2':6,2''-terpyridine)Cl2
-
IC50: 0.0077 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Cu(4'-hydroxo-2,2':6',2''-terpyridine)Cl2
-
IC50: 0.0072 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Cu(4'-[4-methoxyphenyl]-2,2':6',2''-terpyridine)Cl2
-
IC50: 0.0051 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Cu(4'-[p-tolyl]-2,2':6',2''-terpyridine)Cl2
-
0.005 mM
Cu(4,4''-dimethyl-4'-[p-tolyl]-2,2':6',2''-terpyridine)Cl2
-
IC50: 0.014 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Cu(di-[2-picolyl]amine)Cl2
-
IC50: 0.038 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
decanoyl-Arg-Val-Lys-Arg-chloromethylketone
decanoyl-RVKR-chloromethyl ketone
decanoyl-RVRR-chloromethyl ketone
-
-
diisopropyl fluorophosphate
-
-
Eglin c
-
engineered variants
furin-Eda peptide acyclic
-
synthesis, overview. Designed a potent furin inhibitor that contains a highly reactive beta-turn inducing and radical generating enediynyl amino acid moiety, which is inserted between P1 and P19 residues of hfurin98-112 peptide, derived from the primary cleavage site of furin's own prodomain. The inhibitor displays a predominantly beta-turn structure. The inhibitor protects furin protein from self degradation
furin-Eda peptide cyclic
-
synthesis, overview
hfurin25-107
-
i.e. furin prodomain protein, competitive inhibitor, blockade of furin activity and furin-induced tumor cells malignant phenotypes by the chemically synthesized human furin prodomain, overview. Secondary structure of furin prodomain protein, overview
-
histone H1
-
efficiently blocks furin-dependent pro-von Willebrand factor processing in a dose-dependent manner, interaction between histone H1 and furin mainly takes place on the cell surface. H1 may be involved in extracellular and/or intracellular furin regulation
-
human proteinase inhibitor 8
-
-
-
inter-alpha-inhibitor protein IalphaIp
-
blocks furin activity in vitro and provides significant protection against cytotoxocity for murine peritoneal macrophages exposed to up to 500 ng/ml anthrax lethal toxin
-
L-1-chloro-3-(4-tosylamido)-7-amino-2-heptanone
-
-
Lys-Arg chloromethyl ketone
-
-
methyl 4-(bis(4-hydroxy-2-oxo-2H-chromen-3-yl)methyl)benzoate
-
noncompetitive inhibitor
monensin
-
blocks the tumor necrosis factor alpha-induced activation of furin and subsequent neutral sphingomyelinase activation, without altering the basal level of furin
N''-[(1E)-[2-[(4-chlorobenzyl)oxy]phenyl]methylidene]carbonohydrazonic diamide
-
competitive inhibitor
N-(benzo[d][1,3]dioxol-5-yl)-1,2,3,4-tetrahydroacridin-9-amine
-
competitive inhibitor
N-(thiazol-2-yl)-4-(5-((2,4,6-trioxotetrahydropyrimidin-5(6H)-ylidene)methyl)furan-2-yl)benzenesulfonamide
-
competitive inhibitor
N-[3,5-bis[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenyl]-2-[3-[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]-5-[(1Z)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenoxy]acetamide
-
-
N-[3,5-bis[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenyl]-4-carbamimidamidobutanamide
-
-
N-[3,5-bis[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenyl]-5-carbamimidamidopentanamide
-
-
N-[3,5-bis[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenyl]-N'-[3-[(1E)-1-(2-carbamimidoylhydrazinylidene)ethyl]-5-[(1Z)-1-(2-carbamimidoylhydrazinylidene)ethyl]phenyl]propanediamide
-
-
N-[5-guanidino-2,4-bis-(4-guanidino-phenoxy)-cyclohexyl]-guanidine
-
-
N-[5-guanidino-2,4-bis-(5-guanidino-pyridin-2-yloxy)-cyclohexyl]-guanidine
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(3-aminopropyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(3-carbamimidamidopropyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(4-aminobutyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(4-carbamimidamidobutyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(4-carbamimidoylbenzyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(5-aminopentyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(5-carbamimidamidopentyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-(piperidin-4-ylmethyl)-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-[(1-carbamimidoylpiperidin-4-yl)methyl]-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-[3-(aminomethyl)benzyl]-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-[3-(carbamimidamidomethyl)benzyl]-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-[4-(aminomethyl)benzyl]-L-argininamide
-
-
N2-(phenylacetyl)-L-arginyl-L-valyl-N-[4-(carbamimidamidomethyl)benzyl]-L-argininamide
-
-
N2-acetyl-L-arginyl-L-valyl-N-(4-carbamimidoylbenzyl)-L-argininamide
-
-
N2-decanoyl-L-arginyl-L-valyl-N-(4-carbamimidoylbenzyl)-L-argininamide
-
-
N2-decanoyl-L-arginyl-L-valyl-N-(4-carbamimidoylbenzyl)-L-lysinamide
-
-
Octapeptidyl chloromethane inhibitor
-
potent irreversible inhibitor
-
p-hydroxymercuribenzoate
-
-
PenLen (rSAAS-(221-2546))
-
neuroendocrine protein proSAAS-derived peptide
Peptidyl chloroalkyl ketones
-
-
phenylmethanesulfonyl fluoride
profurin 39-62 DYYHFWHRGVKRSLSPHRPRHSR
-
-
profurin 48-62 VTKRSLSPHRPRHSR
-
peptide derived from proprotein convertase 1/3
profurin 54-62 SPHRPRHSR
-
peptide derived from proprotein convertase 1/3
proPC1/3 39-62 NHYLFKHKSHPRRSALAITKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 39-62/A NAYLF KAKSAPRRSRRSALAITKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 50-62 RRSRR SALHITKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 50-83 RRSRRSALHITKRLSDDDRVTWAEQQYEKERSKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 55-62 SALHITKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 55-62/A SALAITKR
-
peptide derived from proprotein convertase 1/3
proPC1/3 74-83 QQYEKERSKR
-
peptide derived from proprotein convertase 1/3
SAAS-(235-244)
-
neuroendocrine protein proSAAS-derived peptide
SAAS-(235-246)
-
neuroendocrine protein proSAAS-derived peptide
-
SAAS-(235-246)P1'A
-
neuroendocrine protein proSAAS-derived peptide
SAAS-(235-246)P2'A
-
neuroendocrine protein proSAAS-derived peptide
-
SAAS-(235-246)P3A
-
neuroendocrine protein proSAAS-derived peptide
SAAS-(235-246)P3AP5A
-
neuroendocrine protein proSAAS-derived peptide
tosyl-Lys chloromethyl ketone
-
-
Zn(4'-[4-methoxyphenyl]-2,2':6',2''-terpyridine)Cl2
-
IC50: 0.009 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Zn(4'-[p-tolyl]-2,2':6',2''-terpyridine)Cl2
-
IC50: 0.009 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
Zn(4,4''-dimethyl-4'-[p-tolyl]-2,2':6',2''-terpyridine)Cl2
-
0.014 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
[Cu(2,2':6,2''-terpyridine)Cl2] (OCl4)
-
IC50: 0.0069 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
alpha1-antitrypsin
-
-
-
alpha1-antitrypsin
-
incorporation of furin recognition sequences within the reactive site loop of alpha1-antiprypsin leads to the production of furin inhibitors, construction of a series of alpha1-antitrypsin mutants by modifying the P7-P1 region of the reactive site loop
-
alpha1-antitrypsin
-
in cells overexpressing alpha1-antitrypsin, mRNA level of furin is reduced
-
Ca2+
-
5-10 mM inhibit
decanoyl-Arg-Val-Lys-Arg-chloromethylketone
-
-
decanoyl-Arg-Val-Lys-Arg-chloromethylketone
-
significantly blocks the processing of ADAMTS4 in HEK-293 cells
decanoyl-Arg-Val-Lys-Arg-chloromethylketone
-
blocks cleavage of the first and second motifs in human hepatoma cells
decanoyl-Arg-Val-Lys-Arg-chloromethylketone
-
fully blocks the substrate cleavage by the wild-type enzyme
decanoyl-RVKR-chloromethyl ketone
-
-
decanoyl-RVKR-chloromethyl ketone
-
inhibition of furin inhibits processing of pro-B-type natriuretic peptide
EDTA
-
-
EDTA
-
completely inhibits
phenylmethanesulfonyl fluoride
-
-
phenylmethanesulfonyl fluoride
-
not
Zn2+
-
-
Zn2+
-
IC50: 0.021 mM, irreversible, competitive with substrate tert-butyloxycarbonyl-Arg-Val-Arg-Arg-4-methylcoumaryl-7-amide
additional information
peptidomimetic compounds based on a phenylacetyl-Arg-Val-Arg-4-(amidomethyl)benzamidine core structure belong to the strongest noncovalent enzyme inhibitors. Upon variation of the P5 position, dramatic changes of the Ki values are observed that cannot be explained by the known recognition motive. The Ki improves by approximately 2 orders of magnitude after addition of basic substituents, e.g., by modification of the Phac-moiety at P5 by a m- or p-guanidinomethyl group. Structure-guided drug design, overview
-
additional information
-
peptidomimetic compounds based on a phenylacetyl-Arg-Val-Arg-4-(amidomethyl)benzamidine core structure belong to the strongest noncovalent enzyme inhibitors. Upon variation of the P5 position, dramatic changes of the Ki values are observed that cannot be explained by the known recognition motive. The Ki improves by approximately 2 orders of magnitude after addition of basic substituents, e.g., by modification of the Phac-moiety at P5 by a m- or p-guanidinomethyl group. Structure-guided drug design, overview
-
additional information
active site distortions of human furin by a small molecule inhibitor N,N'-[[(1S,3R,4R,6S)-4-carbamimidamido-6-(4-carbamimidamidoanilino)cyclohexane-1,3-diyl]bis(oxy-4,1-phenylene)]diguanidine, analysis of binding structures of noncovalent 2,5-dideoxystreptamine-derived furin inhibitors, overview
-
additional information
-
active site distortions of human furin by a small molecule inhibitor N,N'-[[(1S,3R,4R,6S)-4-carbamimidamido-6-(4-carbamimidamidoanilino)cyclohexane-1,3-diyl]bis(oxy-4,1-phenylene)]diguanidine, analysis of binding structures of noncovalent 2,5-dideoxystreptamine-derived furin inhibitors, overview
-
additional information
analysis of the interactions of P4-P6 of furin with substrate-like peptide inhibitors using X-ray crystallography, substrate specificity is mediated at these binding sites, docking study, detailed overview
-
additional information
development of specific inhibitors of furin, synthesis of several truncated analogues of the bicyclic sunflower trypsin inhibitor (SFTI-1), or of compounds by various head-to-tail, head-to-side chain, and side-chain-to-tail cyclizations within multibasic octapeptides, or of several cationic cyclized peptides with cell-penetrating properties, overview. Inhibitory potency of these compounds is determined in enzyme kinetic assays with furin. Inhibitor docking study, crystal structure determination, and structure-function analysis. Modeling of furin in complex with inhibitors N2-(1,3-thiazol-2-yl)-L-arginyl-N-[(1S)-2-amino-2-oxo-1-(4-[[4-(trifluoromethyl)benzyl]oxy]phenyl)ethyl]-L-lysinamide, diphenyl (1-[[(benzyloxy)carbonyl]amino]-3-carbamimidamidopropyl)phosphonate, diphenyl (1-[[(benzyloxy)carbonyl]amino]-4-carbamimidamidobutyl)phosphonate, and diphenyl [2-(4-aminophenyl)-1-[[(benzyloxy)carbonyl]amino]ethyl]phosphonate. Inhibition of respiratory syncytial virus propagation in A549 cells
-
additional information
inhibitor constructuion, synthesis, and structure-function analysis, overview. Evaluation of inhibition of alphavirus propagation and inhibition of diphtheria toxin action
-
additional information
no inhibition of human furin by DFP, 4-(2-aminoethyl)benzensulfonylfluorid (AEBSF), and PMSF
-
additional information
-
not: pepstatin
-
additional information
-
contains Cys near the active site His
-
additional information
-
a potent inhibitor containing a ketomethylene arginyl pseudopeptide bond
-
additional information
-
Boc-RVRR-4-methylcoumarin-7-amide does not show any signs of substrate inhibition
-
additional information
-
the prodomain exhibits inhibitory action toward furin
-
additional information
-
cell-permeable, small-molecule compound, which inhibits furin-mediated cleavage of pro-membrane type-1 matrix metalloproteinase, resulting in a 50% decrease in the invasiveness of the HT1080 cell
-
additional information
-
expression of furin in HaCaT cells declines with respect to time in response to UV radiation irrespective of the type or the dose used
-
additional information
-
siRNA-mediated depletion of endogenous c-Jun NH2-terminal kinase-interacting leucine zipper protein (JLP) or phosphoinositide kinase for position 5 containing a five finger domain (PIKfyve), profoundly delays microtubule-based transport of chimeric furin (Tac-furin) from endosomes to the trans-Golgi network in a CHO cell line, which is rescued upon ectopic expression of siRNA-resistant JLP or PIKfyve constructs
-
additional information
-
EC values of furin inhibitors, overview. Inhibition of cell-surface PA83 processing in cell-based assays, overview
-
additional information
-
no inhibition by metalloprotease inhibitor GM6001
-
additional information
-
O-glycosylation of substrate proBNP in the cleavage site region at Thr71 reduces furin cleaving activity, overview
-
additional information
-
synthetic aromatic enediyne derivatives and their effects on protease activity of proprotein convertases furin, overview
-
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Abortion, Missed
Distribution of furin, TNF-?, and TGF-?2 in the endometrium of missed abortion and voluntary first trimester termination cases.
Acute Kidney Injury
Hemojuvelin Modulates Iron Stress During Acute Kidney Injury: Improved by Furin Inhibitor.
Acute Lung Injury
Leukocyte ADAM17 regulates acute pulmonary inflammation.
adam 17 endopeptidase deficiency
Short-term TNF? shedding is independent of cytoplasmic phosphorylation or furin cleavage of ADAM17.
Adenocarcinoma
A Soluble Form of the Giant Cadherin Fat1 Is Released from Pancreatic Cancer Cells by ADAM10 Mediated Ectodomain Shedding.
Adenocarcinoma
Alternative pathway for the role of furin in tumor cell invasion process. Enhanced MMP-2 levels through bioactive TGFbeta.
Adenocarcinoma
Comparative analysis of expression of the proprotein convertases furin, PACE4, PC1 and PC2 in human lung tumours.
Adenocarcinoma
Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
Adenocarcinoma of Lung
Effect of Furin inhibitor on lung adenocarcinoma cell growth and metastasis.
Adenocarcinoma of Lung
FURIN correlated with immune infiltration serves as a potential biomarker in SARS-CoV-2 infection-related lung adenocarcinoma.
Adenocarcinoma of Lung
Structural variations and expression profiles of the SARS-CoV-2 host invasion genes in lung cancer.
Adenoma
Expression and clinical relevance of paired box protein 7 and sex determining region Y-box 2 in canine corticotroph pituitary adenomas.
Adenoma, Acidophil
A Case of acromegaly associated with subclinical Cushing's disease.
Alzheimer Disease
A ratiometric electrochemical strategy for sensitive determination of Furin activity based on dual signal amplification and antifouling nanosurfaces.
Alzheimer Disease
Familial British dementia: colocalization of furin and ABri amyloid.
Alzheimer Disease
Gallic Acid is a Dual ?/?-Secretase Modulator that Reverses Cognitive Impairment and Remediates Pathology in Alzheimer Mice.
Alzheimer Disease
Genetic regulatory subnetworks and key regulating genes in rat hippocampus perturbed by prenatal malnutrition: implications for major brain disorders.
Alzheimer Disease
Prediction of proprotein convertase cleavage sites.
Alzheimer Disease
Synthetic small molecule furin inhibitors derived from 2,5-dideoxystreptamine.
Alzheimer Disease
The ADAM metalloprotease Kuzbanian is crucial for proper heart formation in Drosophila melanogaster.
Alzheimer Disease
The influence of BACE1 on macrophage recruitment and activity in the injured peripheral nerve.
Alzheimer Disease
Transcriptional repression of the ectodomain sheddase ADAM10 by TBX2 and potential implication for Alzheimer's disease.
Alzheimer Disease
[Generation and characterization of the adult neuron-specific ADAM10 knock-out mice].
Amyloidosis
Gallic Acid is a Dual ?/?-Secretase Modulator that Reverses Cognitive Impairment and Remediates Pathology in Alzheimer Mice.
Amyloidosis
The role of gelsolin domain 3 in familial amyloidosis (Finnish type).
Amyloidosis, Familial
Furin initiates gelsolin familial amyloidosis in the Golgi through a defect in Ca(2+) stabilization.
Amyloidosis, Familial
Gelsolin domain 2 Ca2+ affinity determines susceptibility to furin proteolysis and familial amyloidosis of finnish type.
Amyloidosis, Familial
Pathological and functional amyloid formation orchestrated by the secretory pathway.
Amyloidosis, Familial
The role of gelsolin domain 3 in familial amyloidosis (Finnish type).
Anemia
Regulation of prohepcidin processing and activity by the subtilisin-like proprotein convertases Furin, PC5, PACE4 and PC7.
Anovulation
Oocyte-specific deletion of furin leads to female infertility by causing early secondary follicle arrest in mice.
Anthrax
A femtomol range FRET biosensor reports exceedingly low levels of cell surface furin: implications for the processing of anthrax protective antigen.
Anthrax
A role for PACE4 in the proteolytic activation of anthrax toxin protective antigen.
Anthrax
A urokinase-activated recombinant anthrax toxin is selectively cytotoxic to many human tumor cell types.
Anthrax
Anthrax toxin component, Protective Antigen, protects insects from bacterial infections.
Anthrax
Anthrax toxin protective antigen is activated by a cell surface protease with the sequence specificity and catalytic properties of furin.
Anthrax
Both PA63 and PA83 are endocytosed within an anthrax protective antigen mixed heptamer: A putative mechanism to overcome a furin deficiency.
Anthrax
Cross-inhibition of pathogenic agents and the host proteins they exploit.
Anthrax
Dissecting the urokinase activation pathway using urokinase-activated anthrax toxin.
Anthrax
Furin Protease: From SARS CoV-2 to Anthrax, Diabetes, and Hypertension.
Anthrax
Human furin is a calcium-dependent serine endoprotease that recognizes the sequence Arg-X-X-Arg and efficiently cleaves anthrax toxin protective antigen.
Anthrax
Identification of inhibitors using a cell-based assay for monitoring Golgi-resident protease activity.
Anthrax
Identification of potent and compartment-selective small molecule furin inhibitors using cell-based assays.
Anthrax
Imaging specific cell surface protease activity in living cells using reengineered bacterial cytotoxins.
Anthrax
Inhibition of furin/PC-catalyzed surface and intracellular processing by small molecules.
Anthrax
Inter-alpha-inhibitor proteins are endogenous furin inhibitors and provide protection against experimental anthrax intoxication.
Anthrax
Latent cytokines: development of novel cleavage sites and kinetic analysis of their differential sensitivity to MMP-1 and MMP-3.
Anthrax
Membrane type-1 matrix metalloproteinase (MT1-MMP) protects malignant cells from tumoricidal activity of re-engineered anthrax lethal toxin.
Anthrax
Modeling the activity of furin inhibitors using artificial neural network.
Anthrax
Novel Furin Inhibitors with Potent Anti-infectious Activity.
Anthrax
Oligomerization of anthrax toxin protective antigen and binding of lethal factor during endocytic uptake into mammalian cells.
Anthrax
Potent antitumor activity of a urokinase-activated engineered anthrax toxin.
Anthrax
Prediction of proprotein convertase cleavage sites.
Anthrax
Protection against anthrax toxemia by hexa-D-arginine in vitro and in vivo.
Anthrax
Protection from anthrax toxin-mediated killing of macrophages by the combined effects of furin inhibitors and chloroquine.
Anthrax
Recent Developments in Anti-dotes Against Anthrax.
Anthrax
Role of furin in delivery of a CTL epitope of an anthrax toxin-fusion protein.
Anthrax
Selective and potent furin inhibitors protect cells from anthrax without significant toxicity.
Anthrax
Synthetic small molecule furin inhibitors derived from 2,5-dideoxystreptamine.
Anthrax
Targeting of tumor cells by cell surface urokinase plasminogen activator-dependent anthrax toxin.
Anthrax
Targeting the membrane-anchored serine protease testisin with a novel engineered anthrax toxin prodrug to kill tumor cells and reduce tumor burden.
Anthrax
The crystal structure of the proprotein processing proteinase furin explains its stringent specificity.
Anthrax
The kindest cuts of all: crystal structures of Kex2 and furin reveal secrets of precursor processing.
Anthrax
Tumor cell-selective cytotoxicity of matrix metalloproteinase-activated anthrax toxin.
Aortic Valve Stenosis
Distinct downregulation of C-type natriuretic peptide system in human aortic valve stenosis.
Arthritis
Furin Expression in Patients With Psoriasis-A Patient Cohort Endangered to SARS-COV2?
Arthritis
Protective role of systemic furin in immune response-induced arthritis.
Arthritis, Rheumatoid
Increased expression of the proprotein convertase enzyme FURIN in rheumatoid arthritis.
Arthritis, Rheumatoid
Increased FURIN expression in rheumatoid arthritis patients and its anti-inflammatory effect.
Arthritis, Rheumatoid
Inhibition of furin results in increased growth, invasiveness and cytokine production of synoviocytes from patients with rheumatoid arthritis.
Arthritis, Rheumatoid
Proprotein convertase enzyme FURIN is upregulated in primary Sjögren's syndrome.
Asthma
A potential new target for asthma therapy: A Disintegrin and Metalloprotease 10 (ADAM10) involvement in murine experimental asthma.
Asthma
ACE2 expression is elevated in airway epithelial cells from older and male healthy individuals but reduced in asthma.
Asthma
Correction to: Sputum ACE2, TMPRSS2 and FURIN gene expression in severe neutrophilic asthma.
Asthma
Sputum ACE2, TMPRSS2 and FURIN gene expression in severe neutrophilic asthma.
Astrocytoma
Inhibition of furin-mediated processing results in suppression of astrocytoma cell growth and invasiveness.
Atherosclerosis
A disintegrin and metalloprotease 10 is a novel mediator of vascular endothelial growth factor-induced endothelial cell function in angiogenesis and is associated with atherosclerosis.
Atherosclerosis
FURIN Inhibition Reduces Vascular Remodeling and Atherosclerotic Lesion Progression in Mice.
Atherosclerosis
Furin-like proprotein convertases are central regulators of the membrane type matrix metalloproteinase-pro-matrix metalloproteinase-2 proteolytic cascade in atherosclerosis.
Atherosclerosis
Hepatic overexpression of the prodomain of furin lessens progression of atherosclerosis and reduces vascular remodeling in response to injury.
Atherosclerosis
Immunohistochemical localization of subtilisin/kexin-like proprotein convertases in human atherosclerosis.
Atherosclerosis
Proprotein convertase enzyme FURIN is upregulated in primary Sjögren's syndrome.
Atherosclerosis
Proprotein convertase furin/PCSK3 and atherosclerosis: New insights and potential therapeutic targets.
Atherosclerosis
Proprotein convertases furin and PC5: targeting atherosclerosis and restenosis at multiple levels.
Atherosclerosis
Proprotein convertases in atherogenesis.
Atherosclerosis
Proprotein convertases in human atherosclerotic plaques: the overexpression of FURIN and its substrate cytokines BAFF and APRIL.
Autoimmune Diseases
Furin inhibits epithelial cell injury and alleviates experimental colitis by activating the Nrf2-Gpx4 signaling pathway.
Autoimmune Diseases
The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
Autoimmune Diseases
The Role of Proprotein Convertases in the Regulation of the Function of Immune Cells in the Oncoimmune Response.
Autoimmune Hypophysitis
Frequent appearance of autoantibodies against prohormone convertase 1/3 and neuroendocrine protein 7B2 in patients with nonfunctioning pituitary macroadenoma.
Bacterial Infections
Chemical structure and properties of low-molecular furin inhibitors.
Bacterial Infections
Human furin Cys198 imposes dihedral and positional restraints on His194 for optimal Ser386-proton transfer.
Bacterial Infections
Synthetic small molecule furin inhibitors derived from 2,5-dideoxystreptamine.
Bacterial Infections
Why All the Fury over Furin?
Bacterial Infections
[Furin and its biological role]
Bone Resorption
Proprotein convertase furin regulates osteocalcin and bone endocrine function.
Borna Disease
Processing of the Borna disease virus glycoprotein gp94 by the subtilisin-like endoprotease furin.
Brain Ischemia
Furin-mediated cleavage of LRP1 and increase in ICD of LRP1 after cerebral ischemia and after exposure of cultured neurons to NMDA.
Brain Neoplasms
Opposite roles of furin and PC5A in N-cadherin processing.
Breast Neoplasms
ADAM10 releases a soluble form of the GPNMB/Osteoactivin extracellular domain with angiogenic properties.
Breast Neoplasms
Cancer/testis antigen-Plac1 promotes invasion and metastasis of breast cancer through Furin/NICD/PTEN signaling pathway.
Breast Neoplasms
Characterization of structural determinants and molecular mechanisms involved in pro-stromelysin-3 activation by 4-aminophenylmercuric acetate and furin-type convertases.
Breast Neoplasms
Elevated expression of proprotein convertases alters breast cancer cell growth in response to estrogen and tamoxifen.
Breast Neoplasms
Fas/FasL-dependent and -independent activation of caspase-8 in doxorubicin-treated human breast cancer MCF-7 cells: ADAM10 down-regulation activates Fas/FasL signaling pathway.
Breast Neoplasms
Furin Prodomain ppFurin Enhances Ca2+ Entry Through Orai and TRPC6 Channels' Activation in Breast Cancer Cells.
Breast Neoplasms
Furin-instructed aggregated gold nanoparticles for re-educating tumor associated macrophages and overcoming breast cancer chemoresistance.
Breast Neoplasms
Identification of ADAM10 as a Major Source of HER2 Ectodomain Sheddase Activity in HER2 Overexpressing Breast Cancer Cells.
Breast Neoplasms
In Vivo Bioluminescence Imaging of Furin Activity in Breast Cancer Cells Using Bioluminogenic Substrates.
Breast Neoplasms
Inhibition of furin by bone targeting superparamagnetic iron oxide nanoparticles alleviated breast cancer bone metastasis.
Breast Neoplasms
Lipoic acid decreases breast cancer cell proliferation by inhibiting IGF-1R via furin downregulation.
Breast Neoplasms
Lipoic acid-induced oxidative stress abrogates IGF-1R maturation by inhibiting the CREB/furin axis in breast cancer cell lines.
Breast Neoplasms
Loss of Proprotein Convertase Furin in Mammary Gland Impairs proIGF1R and proIR Processing and Suppresses Tumorigenesis in Triple Negative Breast Cancer.
Breast Neoplasms
Loss of the proprotein convertase Furin in T cells represses mammary tumorigenesis in oncogene-driven triple negative breast cancer.
Breast Neoplasms
Mutation analysis of membrane type-1 matrix metalloproteinase (MT1-MMP). The role of the cytoplasmic tail Cys(574), the active site Glu(240), and furin cleavage motifs in oligomerization, processing, and self-proteolysis of MT1-MMP expressed in breast carcinoma cells.
Breast Neoplasms
Opposing function of the proprotein convertases furin and PACE4 on breast cancer cells' malignant phenotypes: role of tissue inhibitors of metalloproteinase-1.
Breast Neoplasms
Pro-protein convertase gene expression in human breast cancer.
Breast Neoplasms
Synergistic inhibition with a dual epidermal growth factor receptor/HER-2/neu tyrosine kinase inhibitor and a disintegrin and metalloprotease inhibitor.
Breast Neoplasms
Targeted therapy in breast cancer: what's new?
Breast Neoplasms
The proprotein convertase furin in tumour progression.
Bronchitis
Characterization of cellular furin content as a potential factor determining the susceptibility of cultured human and animal cells to coronavirus infectious bronchitis virus infection.
Bronchitis
Proteolytic activation of the spike protein at a novel RRRR/S motif is implicated in furin-dependent entry, syncytium formation, and infectivity of coronavirus infectious bronchitis virus in cultured cells.
CADASIL
Functional analysis of a recurrent missense mutation in Notch3 in CADASIL.
Carcinogenesis
Alternative pathway for the role of furin in tumor cell invasion process. Enhanced MMP-2 levels through bioactive TGFbeta.
Carcinogenesis
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Carcinogenesis
FurinDB: A Database of 20-Residue Furin Cleavage Site Motifs, Substrates and Their Associated Drugs.
Carcinogenesis
Heparan sulfate regulates ADAM12 through a molecular switch mechanism.
Carcinogenesis
Hypoxia enhances cancer cell invasion through relocalization of the proprotein convertase furin from the trans-Golgi network to the cell surface.
Carcinogenesis
Hypoxia-enhanced expression of the proprotein convertase furin is mediated by hypoxia-inducible factor-1: impact on the bioactivation of proproteins.
Carcinogenesis
Identification of inhibitors using a cell-based assay for monitoring Golgi-resident protease activity.
Carcinogenesis
Limitations of inhibitory activities of polyphenols on furin-mediated substrate processing.
Carcinogenesis
Loss of Proprotein Convertase Furin in Mammary Gland Impairs proIGF1R and proIR Processing and Suppresses Tumorigenesis in Triple Negative Breast Cancer.
Carcinogenesis
Loss of the proprotein convertase Furin in T cells represses mammary tumorigenesis in oncogene-driven triple negative breast cancer.
Carcinogenesis
MMTV-cre-mediated fur inactivation concomitant with PLAG1 proto-oncogene activation delays salivary gland tumorigenesis in mice.
Carcinogenesis
Near-Infrared Fluorescent Furin Probe for Revealing the Role of Furin in Cellular Carcinogenesis and Specific Cancer Imaging.
Carcinogenesis
Pirfenidone inhibits TGF-beta expression in malignant glioma cells.
Carcinogenesis
Sheddase Activity of Tumor Necrosis Factor-{alpha} Converting Enzyme Is Increased and Prognostically Valuable in Head and Neck Cancer.
Carcinogenesis
T-cell-expressed proprotein convertase FURIN inhibits DMBA/TPA-induced skin cancer development.
Carcinogenesis
The non-receptor tyrosine kinase c-Src mediates the PDGF-induced association between Furin and pro-MT1-MMP in HPAC pancreatic cells.
Carcinogenesis
The proprotein convertase furin is a pro-oncogenic driver in KRAS and BRAF driven colorectal cancer.
Carcinogenesis
The proprotein convertase PC5/6 is protective against intestinal tumorigenesis: in vivo mouse model.
Carcinogenesis
The secretory proprotein convertases furin, PC5, and PC7 activate VEGF-C to induce tumorigenesis.
Carcinogenesis
Transgenic overexpression of the proprotein convertase furin enhances skin tumor growth.
Carcinoid Tumor
Expression of prohormone convertase, PC2, in adrenocorticotropin-producing thymic carcinoid with elevated plasma corticotropin-releasing hormone.
Carcinoid Tumor
Immunohistochemical expressions of prohormone convertase (PC)1/3 and PC2 in carcinoids of various organs.
Carcinoma
A mutation of furin causes the lack of precursor-processing activity in human colon carcinoma LoVo cells.
Carcinoma
A second mutant allele of furin in the processing-incompetent cell line, LoVo. Evidence for involvement of the homo B domain in autocatalytic activation.
Carcinoma
Autocatalytic activation of the furin zymogen requires removal of the emerging enzyme's N-terminus from the active site.
Carcinoma
Comparative analysis of expression of the proprotein convertases furin, PACE4, PC1 and PC2 in human lung tumours.
Carcinoma
Correction: Simultaneous Expression of Furin and Vascular Endothelial Growth Factor in Human Oral Tongue Squamous Cell Carcinoma Progression.
Carcinoma
Direct role of furin in mammalian prosomatostatin processing.
Carcinoma
Effect of ultraviolet radiation on the expression of pp38MAPK and furin in human keratinocyte-derived cell lines.
Carcinoma
ELA/APELA precursor cleaved by furin displays tumor suppressor function in renal cell carcinoma through mTORC1 activation.
Carcinoma
Elevated furin expression in aggressive human head and neck tumors and tumor cell lines.
Carcinoma
Engineered serine protease inhibitor prevents furin-catalyzed activation of the fusion glycoprotein and production of infectious measles virus.
Carcinoma
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Carcinoma
ERBB3-induced furin promotes the progression and metastasis of ovarian cancer via the IGF1R/STAT3 signaling axis.
Carcinoma
Evidence for involvement of furin in cleavage and activation of diphtheria toxin.
Carcinoma
Furin expression in squamous cell carcinomas of the oral cavity and other sites evaluated by tissue microarray technology.
Carcinoma
Furin inhibition results in absent or decreased invasiveness and tumorigenicity of human cancer cells.
Carcinoma
GPR37 is processed in the N-terminal ectodomain by ADAM10 and furin.
Carcinoma
Human carcinoma cell growth and invasiveness is impaired by the propeptide of the ubiquitous proprotein convertase furin.
Carcinoma
Mutation analysis of membrane type-1 matrix metalloproteinase (MT1-MMP). The role of the cytoplasmic tail Cys(574), the active site Glu(240), and furin cleavage motifs in oligomerization, processing, and self-proteolysis of MT1-MMP expressed in breast carcinoma cells.
Carcinoma
Prodomain of the proprotein convertase subtilisin/kexin Furin (ppFurin) protects from tumor progression and metastasis.
Carcinoma
Prohormone convertase and autocrine growth factor mRNAs are coexpressed in small cell lung carcinoma.
Carcinoma
Proteolytic cleavage of glycoprotein B is dispensable for in vitro replication, but required for syncytium formation of pseudorabies virus.
Carcinoma
Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells.
Carcinoma
Selective inhibition of proprotein convertases represses the metastatic potential of human colorectal tumor cells.
Carcinoma
Simultaneous expression of furin and vascular endothelial growth factor in human oral tongue squamous cell carcinoma progression.
Carcinoma
Soluble Form of the (Pro)Renin Receptor Generated by Intracellular Cleavage by Furin Is Secreted in Plasma.
Carcinoma
Targeting the sheddase activity of ADAM17 by an anti-ADAM17 antibody D1(A12) inhibits head and neck squamous cell carcinoma cell proliferation and motility via blockage of bradykinin induced HERs transactivation.
Carcinoma
The proprotein convertase furin in tumour progression.
Carcinoma
The proteolytic processing of pro-platelet-derived growth factor-A at RRKR(86) by members of the proprotein convertase family is functionally correlated to platelet-derived growth factor-A-induced functions and tumorigenicity.
Carcinoma
The secretory proprotein convertases furin, PC5, and PC7 activate VEGF-C to induce tumorigenesis.
Carcinoma
Transgenic overexpression of the proprotein convertase furin enhances skin tumor growth.
Carcinoma
[Membrane type 1 matrix metalloproteinase (MT1-MMP) and the regulators of its activity as invasive factors in squamous cell cervical carcinomas.]
Carcinoma
[Tissue collagenase MMP-14 and endogenous regulators of its activity in the corpus uteri in squamous cell carcinoma of the cervix].
Carcinoma, Hepatocellular
Enzymatic inhibition of MICA sheddase ADAM17 by lomofungin in hepatocellular carcinoma cells.
Carcinoma, Hepatocellular
Furin overexpression suppresses tumor growth and predicts a better postoperative disease-free survival in hepatocellular carcinoma.
Carcinoma, Hepatocellular
Liver-Specific Inactivation of the Proprotein Convertase FURIN Leads to Increased Hepatocellular Carcinoma Growth.
Carcinoma, Hepatocellular
Polyphenols with indirect proprotein convertase inhibitory activity.
Carcinoma, Hepatocellular
Regulated production of mature insulin by non-beta-cells.
Carcinoma, Hepatocellular
Suppression of furin by interferon-? and the impact on hepatitis B virus antigen biosynthesis in human hepatocytes.
Carcinoma, Hepatocellular
Thyroid hormone promotes cell invasion through activation of furin expression in human hepatoma cell lines.
Carcinoma, Non-Small-Cell Lung
Proprotein convertase furin in SARS-CoV-2 and non-small cell lung cancer.
Carcinoma, Renal Cell
ELA/APELA precursor cleaved by furin displays tumor suppressor function in renal cell carcinoma through mTORC1 activation.
Carcinoma, Squamous Cell
Comparative analysis of expression of the proprotein convertases furin, PACE4, PC1 and PC2 in human lung tumours.
Carcinoma, Squamous Cell
Correction: Simultaneous Expression of Furin and Vascular Endothelial Growth Factor in Human Oral Tongue Squamous Cell Carcinoma Progression.
Carcinoma, Squamous Cell
Effect of ultraviolet radiation on the expression of pp38MAPK and furin in human keratinocyte-derived cell lines.
Carcinoma, Squamous Cell
Elevated furin expression in aggressive human head and neck tumors and tumor cell lines.
Carcinoma, Squamous Cell
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Carcinoma, Squamous Cell
Furin expression in squamous cell carcinomas of the oral cavity and other sites evaluated by tissue microarray technology.
Carcinoma, Squamous Cell
Furin inhibition results in absent or decreased invasiveness and tumorigenicity of human cancer cells.
Carcinoma, Squamous Cell
Human carcinoma cell growth and invasiveness is impaired by the propeptide of the ubiquitous proprotein convertase furin.
Carcinoma, Squamous Cell
Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells.
Carcinoma, Squamous Cell
Simultaneous expression of furin and vascular endothelial growth factor in human oral tongue squamous cell carcinoma progression.
Carcinoma, Squamous Cell
Structural variations and expression profiles of the SARS-CoV-2 host invasion genes in lung cancer.
Carcinoma, Squamous Cell
Targeting the sheddase activity of ADAM17 by an anti-ADAM17 antibody D1(A12) inhibits head and neck squamous cell carcinoma cell proliferation and motility via blockage of bradykinin induced HERs transactivation.
Carcinoma, Squamous Cell
The proprotein convertase furin in tumour progression.
Carcinoma, Squamous Cell
Transgenic overexpression of the proprotein convertase furin enhances skin tumor growth.
Carcinoma, Squamous Cell
[Tissue collagenase MMP-14 and endogenous regulators of its activity in the corpus uteri in squamous cell carcinoma of the cervix].
Cardiomyopathies
RNA sequencing analysis and atrial natriuretic Peptide production in patients with dilated and ischemic cardiomyopathy.
Cardiovascular Diseases
Proprotein convertase furin/PCSK3 and atherosclerosis: New insights and potential therapeutic targets.
Chikungunya Fever
Inhibition of Chikungunya virus infection in cultured human muscle cells by furin inhibitors: impairment of the maturation of the E2 surface glycoprotein.
Cholera
Low-cost production of proinsulin in tobacco and lettuce chloroplasts for injectable or oral delivery of functional insulin and C-peptide.
Cholera
Oral delivery of bioencapsulated coagulation factor IX prevents inhibitor formation and fatal anaphylaxis in hemophilia B mice.
Cholera
Receptor-mediated oral delivery of a bioencapsulated green fluorescent protein expressed in transgenic chloroplasts into the mouse circulatory system.
Cholera
The ubiquitin ligase RNF126 regulates the retrograde sorting of the cation-independent mannose 6-phosphate receptor.
Choriocarcinoma
FURIN and placental syncytialisation: a cautionary tale.
Choriocarcinoma
The (pro)renin receptor and soluble (pro)renin receptor in choriocarcinoma.
Choriocarcinoma
The cAMP-responsive element binding protein (CREB) transcription factor regulates furin expression during human trophoblast syncytialization.
Choriocarcinoma
The proprotein convertase furin is required for trophoblast syncytialization.
Choroidal Neovascularization
A Sema3C Mutant Resistant to Cleavage by Furin (FR-Sema3C) Inhibits Choroidal Neovascularization.
Coinfection
Production and characterization of simian--human immunodeficiency virus-like particles.
Coinfection
Proparathyroid hormone processing by the proprotein convertase-7: comparison with furin and assessment of modulation of parathyroid convertase messenger ribonucleic acid levels by calcium and 1,25-dihydroxyvitamin D3.
Coinfection
Proteolytic processing of human cytomegalovirus glycoprotein B (gpUL55) is mediated by the human endoprotease furin.
Colitis
Furin inhibits epithelial cell injury and alleviates experimental colitis by activating the Nrf2-Gpx4 signaling pathway.
Colitis, Ulcerative
Furin inhibits epithelial cell injury and alleviates experimental colitis by activating the Nrf2-Gpx4 signaling pathway.
Colonic Neoplasms
Inactivation of proprotein convertases in T cells inhibits PD-1 expression and creates a favorable immune microenvironment in colorectal cancer.
Colonic Neoplasms
Proprotein-processing endoproteases PC6 and furin both activate hemagglutinin of virulent avian influenza viruses.
Colonic Neoplasms
Single Nucleotide Polymorphism (rs4932178) in the P1 Promoter of FURIN Is Not Prognostic to Colon Cancer.
Colorectal Neoplasms
Inclusion of a Furin Cleavage Site Enhances Antitumor Efficacy against Colorectal Cancer Cells of Ribotoxin ?-Sarcin- or RNase T1-Based Immunotoxins.
Colorectal Neoplasms
The proprotein convertase furin is a pro-oncogenic driver in KRAS and BRAF driven colorectal cancer.
Communicable Diseases
Elongated and Shortened Peptidomimetic Inhibitors of the Proprotein Convertase Furin.
Communicable Diseases
Furin-mediated protein processing in infectious diseases and cancer.
Communicable Diseases
Highly potent inhibitors of proprotein convertase furin as potential drugs for treatment of infectious diseases.
Communicable Diseases
Novel Furin Inhibitors with Potent Anti-infectious Activity.
Communicable Diseases
T-cell-expressed proprotein convertase furin is essential for maintenance of peripheral immune tolerance.
Communicable Diseases
The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
Communicable Diseases
Therapeutic uses of furin and its inhibitors: a patent review.
Coronary Artery Disease
FURIN Expression in Vascular Endothelial Cells Is Modulated by a Coronary Artery Disease-Associated Genetic Variant and Influences Monocyte Transendothelial Migration.
Coronary Artery Disease
FURIN Inhibition Reduces Vascular Remodeling and Atherosclerotic Lesion Progression in Mice.
Coronary Artery Disease
Platelet Activation and Plasma Levels of Furin Are Associated With Prognosis of Patients With Coronary Artery Disease and COVID-19.
Coronavirus Infections
A Fluorogenic Peptide Cleavage Assay to Screen for Proteolytic Activity: Applications for coronavirus spike protein activation.
Coronavirus Infections
Middle East Respiratory Syndrome Coronavirus Spike Protein Is Not Activated Directly by Cellular Furin during Viral Entry into Target Cells.
Coronavirus Infections
Whole Genome Analysis and Targeted Drug Discovery Using Computational Methods and High Throughput Screening Tools for Emerged Novel Coronavirus (2019-nCoV).
COVID-19
A bird eye view on cystic fibrosis: An underestimated multifaceted chronic disorder.
COVID-19
A Multibasic Cleavage Site in the Spike Protein of SARS-CoV-2 Is Essential for Infection of Human Lung Cells.
COVID-19
A multicenter consensus: A role of furin in the endothelial tropism in obese patients with COVID-19 infection.
COVID-19
ACE2 and Furin Expressions in Oral Epithelial Cells Possibly Facilitate COVID-19 Infection via Respiratory and Fecal-Oral Routes.
COVID-19
ACE2 and FURIN variants are potential predictors of SARS-CoV-2 outcome: A time to implement precision medicine against COVID-19.
COVID-19
ACE2, TMPRSS2, and furin gene expression in the airways of people with asthma-implications for COVID-19.
COVID-19
ACE2, TMPRSS2, and Furin variants and SARS-CoV-2 infection in Madrid, Spain.
COVID-19
Assessing COVID-19 susceptibility through analysis of the genetic and epigenetic diversity of ACE2-mediated SARS-CoV-2 entry.
COVID-19
Association between circulating furin levels, obesity and pro-inflammatory markers in children.
COVID-19
Circulating furin, IL-6, and presepsin levels and disease severity in SARS-CoV-2-infected patients.
COVID-19
Comparison of clinically approved molecules on SARS-CoV-2 drug target proteins: a molecular docking study.
COVID-19
COVID-19 and cancer: Sailing through the tides.
COVID-19
COVID-19 and Genetic Variants of Protein Involved in the SARS-CoV-2 Entry into the Host Cells.
COVID-19
COVID-19 in Smokeless Tobacco Habitués: Increased Susceptibility and Transmission.
COVID-19
Cryo-EM structure of S-Trimer, a subunit vaccine candidate for COVID-19.
COVID-19
Enzyme inhibition as a potential therapeutic strategy to treat COVID-19 infection.
COVID-19
Ephrin-A1 and the sheddase ADAM12 are upregulated in COVID-19.
COVID-19
Epigenetic underpinnings of inflammation: Connecting the dots between pulmonary diseases, lung cancer and COVID-19.
COVID-19
Existence of SARS-CoV-2 Entry Molecules in the Oral Cavity.
COVID-19
Expression of ACE2, TMPRSS2, and Furin in Mouse Ear Tissue, and the Implications for SARS-CoV-2 Infection.
COVID-19
Expression of angiotensin-converting enzyme 2 and proteases in COVID-19 patients: A potential role of cellular FURIN in the pathogenesis of SARS-CoV-2.
COVID-19
Expression profiles of the SARS-CoV-2 host invasion genes in nasopharyngeal and oropharyngeal swabs of COVID-19 patients.
COVID-19
Fibrinolysis influences SARS-CoV-2 infection in ciliated cells.
COVID-19
Functional prediction and comparative population analysis of variants in genes for proteases and innate immunity related to SARS-CoV-2 infection.
COVID-19
FURIN correlated with immune infiltration serves as a potential biomarker in SARS-CoV-2 infection-related lung adenocarcinoma.
COVID-19
Furin Expression in Patients With Psoriasis-A Patient Cohort Endangered to SARS-COV2?
COVID-19
Furin Inhibitors Block SARS-CoV-2 Spike Protein Cleavage to Suppress Virus Production and Cytopathic Effects.
COVID-19
Furin Protease: From SARS CoV-2 to Anthrax, Diabetes, and Hypertension.
COVID-19
Furin: A Potential Therapeutic Target for COVID-19.
COVID-19
Genomic Feature Analysis of Betacoronavirus Provides Insights Into SARS and COVID-19 Pandemics.
COVID-19
How Do Enveloped Viruses Exploit the Secretory Proprotein Convertases to Regulate Infectivity and Spread?
COVID-19
Immune Interaction Map of Human SARS-CoV-2 Target Genes: Implications for Therapeutic Avenues.
COVID-19
Increased mortality of COVID-19 infected diabetes patients: role of furin proteases.
COVID-19
Instigators of COVID-19 in Immune Cells are Increased in Tobacco Cigarette Smokers and Electronic Cigarette Vapers Compared to Non-smokers.
COVID-19
Lung expression of genes putatively involved in SARS-CoV-2 infection is modulated in cis by germline variants.
COVID-19
Multimodal single-cell omics analysis identifies epithelium-immune cell interactions and immune vulnerability associated with sex differences in COVID-19.
COVID-19
Osmotic Adaptation by Na+-Dependent Transporters and ACE2: Correlation with Hemostatic Crisis in COVID-19.
COVID-19
Persistently Increased Systemic ACE2 Activity Is Associated With an Increased Inflammatory Response in Smokers With COVID-19.
COVID-19
Phytopharmaceuticals mediated Furin and TMPRSS2 receptor blocking: can it be a potential therapeutic option for Covid-19?
COVID-19
Placental response to maternal SARS-CoV-2 infection.
COVID-19
Platelet Activation and Plasma Levels of Furin Are Associated With Prognosis of Patients With Coronary Artery Disease and COVID-19.
COVID-19
Profiling COVID-19 Genetic Research: A Data-Driven Study Utilizing Intelligent Bibliometrics.
COVID-19
Pulmonary, cardiac and renal distribution of ACE2, furin, TMPRSS2 and ADAM17 in rats with heart failure: Potential implication for COVID-19 disease.
COVID-19
Single-cell analysis of SARS-CoV-2 receptor ACE2 and spike protein priming expression of proteases in the human heart.
COVID-19
Structure of Furin Protease Binding to SARS-CoV-2 Spike Glycoprotein and Implications for Potential Targets and Virulence.
COVID-19
Synergy of melanin and vitamin-D may play a fundamental role in preventing SARS-CoV-2 infections and halt COVID-19 by inactivating furin protease.
COVID-19
The conundrum of using hyperoxia in COVID-19 treatment strategies: may intermittent therapeutic hyperoxia play a helpful role in the expression of the surface receptors ACE2 and Furin in lung tissue via triggering of HIF-1??
COVID-19
The effect of coronaviruses on olfaction: systematic review.
COVID-19
The Polybasic Cleavage Site in SARS-CoV-2 Spike Modulates Viral Sensitivity to Type I Interferon and IFITM2.
COVID-19
The Potential Role of Osteopontin and Furin in Worsening Disease Outcomes in COVID-19 Patients with Pre-Existing Diabetes.
COVID-19
The role of high cholesterol in age-related COVID19 lethality.
COVID-19
Tripartite Combination of Candidate Pandemic Mitigation Agents: Vitamin D, Quercetin, and Estradiol Manifest Properties of Medicinal Agents for Targeted Mitigation of the COVID-19 Pandemic Defined by Genomics-Guided Tracing of SARS-CoV-2 Targets in Human Cells.
COVID-19
Virus strain from a mild COVID-19 patient in Hangzhou represents a new trend in SARS-CoV-2 evolution potentially related to Furin cleavage site.
COVID-19
Why All the Fury over Furin?
COVID-19
[Mechanism of QingfeiPaidu decoction for treatment of COVID-19: analysis based on network pharmacology and molecular docking technology].
Creutzfeldt-Jakob Syndrome
TREM2 expression in the brain and biological fluids in prion diseases.
Cystic Fibrosis
Elevated furin levels in human cystic fibrosis cells result in hypersusceptibility to exotoxin A-induced cytotoxicity.
Cystic Fibrosis
SARS-CoV-2 Entry Genes Expression in Relation with Interferon Response in Cystic Fibrosis Patients.
Dementia
Familial British dementia: colocalization of furin and ABri amyloid.
Dementia
Furin mediates enhanced production of fibrillogenic ABri peptides in familial British dementia.
Dengue
A multicenter consensus: A role of furin in the endothelial tropism in obese patients with COVID-19 infection.
Dengue
Dengue virus capsid anchor modulates the efficiency of polyprotein processing and assembly of viral particles.
Dengue
Differential modulation of prM cleavage, extracellular particle distribution, and virus infectivity by conserved residues at nonfurin consensus positions of the dengue virus pr-M junction.
Dengue
Effects of NS2B-NS3 protease and furin inhibition on West Nile and Dengue virus replication.
Dengue
Enhancing dengue virus maturation using a stable furin over-expressing cell line.
Dengue
Flavivirus maturation leads to the formation of an occupied lipid pocket in the surface glycoproteins.
Dengue
Luteolin restricts dengue virus replication through inhibition of the proprotein convertase furin.
Dengue
Obstruction of dengue virus maturation by Fab fragments of the 2H2 antibody.
Dengue
Optimization of Substrate-Analogue Furin Inhibitors.
Dengue
Structure of the immature dengue virus at low pH primes proteolytic maturation.
Dengue
Substrate specificity of recombinant dengue 2 virus NS2B-NS3 protease: influence of natural and unnatural basic amino acids on hydrolysis of synthetic fluorescent substrates.
Diabetes Mellitus
A case of prohormone convertase deficiency diagnosed with type 2 diabetes.
Diabetes Mellitus
Diagnostic utility of BNP, corin and furin as biomarkers for cardiovascular complications in type 2 diabetes mellitus patients.
Diabetes Mellitus
Immune Interaction Map of Human SARS-CoV-2 Target Genes: Implications for Therapeutic Avenues.
Diabetes Mellitus
Plasma levels of the proprotein convertase furin and incidence of diabetes and mortality.
Diabetes Mellitus
The Potential Role of Osteopontin and Furin in Worsening Disease Outcomes in COVID-19 Patients with Pre-Existing Diabetes.
Diabetes Mellitus
Topical GDF11 accelerates skin wound healing in both type 1 and 2 diabetic mouse models.
Diabetes Mellitus, Type 2
A case of prohormone convertase deficiency diagnosed with type 2 diabetes.
Diabetes Mellitus, Type 2
Diagnostic utility of BNP, corin and furin as biomarkers for cardiovascular complications in type 2 diabetes mellitus patients.
Diphtheria
A novel recombinant immuno-tBid with a furin site effectively suppresses the growth of HER2-positive osteosarcoma cells in vitro.
Diphtheria
A role for PACE4 in the proteolytic activation of anthrax toxin protective antigen.
Diphtheria
A urokinase-activated recombinant diphtheria toxin targeting the granulocyte-macrophage colony-stimulating factor receptor is selectively cytotoxic to human acute myeloid leukemia blasts.
Diphtheria
Anti-tumor effects of a recombinant anti-prostate specific membrane antigen immunotoxin against prostate cancer cells.
Diphtheria
Evidence for involvement of furin in cleavage and activation of diphtheria toxin.
Diphtheria
Identification of inhibitors using a cell-based assay for monitoring Golgi-resident protease activity.
Diphtheria
Limitations of inhibitory activities of polyphenols on furin-mediated substrate processing.
Diphtheria
Novel Furin Inhibitors with Potent Anti-infectious Activity.
Diphtheria
Pseudomonas exotoxin exhibits increased sensitivity to furin when sequences at the cleavage site are mutated to resemble the arginine-rich loop of diphtheria toxin.
Diphtheria
Recombinant immunoproapoptotic proteins with furin site can translocate and kill HER2-positive cancer cells.
Diphtheria
The effect of direct translocation across endosomes on the cytotoxicity of the recombinant protein e23sFv-Fdt-casp6 to HER2 positive gastric cancer cells.
Dry Eye Syndromes
Proprotein convertase enzyme FURIN is upregulated in primary Sjögren's syndrome.
Ectodermal Dysplasia 1, Anhidrotic
Mutations within a furin consensus sequence block proteolytic release of ectodysplasin-A and cause X-linked hypohidrotic ectodermal dysplasia.
Encephalitis
Gallic Acid is a Dual ?/?-Secretase Modulator that Reverses Cognitive Impairment and Remediates Pathology in Alzheimer Mice.
Encephalitis
The furin-S2' site in avian coronavirus plays a key role in central nervous system damage progression.
Encephalitis, Tick-Borne
Proteolytic activation of tick-borne encephalitis virus by furin.
Encephalitis, Tick-Borne
Resuscitating mutations in a furin cleavage-deficient mutant of the flavivirus tick-borne encephalitis virus.
Encephalomyelitis, Venezuelan Equine
Antibody to the E3 Glycoprotein Protects Mice Against Lethal Venezuelan Equine Encephalitis.
Endometrial Neoplasms
Proprotein convertases in post-menopausal endometrial cancer: Distinctive regulation and non-invasive diagnosis.
Endometrial Neoplasms
The significance of post-translational removal of ?-DG-N in early stage endometrial cancer development.
Endometriosis
ADAM-10 and -17 regulate endometriotic cell migration via concerted ligand and receptor shedding feedback on kinase signaling.
Epilepsy
Implications of the subtilisin/kexin-like precursor convertases in the development and function of nervous tissues.
Epilepsy
Transgenic overexpression of furin increases epileptic susceptibility.
Essential Hypertension
Associations between genetic variations in the FURIN gene and hypertension.
Exocrine Pancreatic Insufficiency
SARS-CoV-2 Entry Genes Expression in Relation with Interferon Response in Cystic Fibrosis Patients.
Fetal Growth Retardation
Altered serum soluble furin and prorenin receptor levels in pregnancies with pre-eclampsia and fetal growth restriction.
Foot-and-Mouth Disease
Co-expression of self-cleaved multiple proteins derived from Porcine Reproductive and Respiratory Syndrome Virus by bi-cistronic and tri-cistronic DNA vaccines.
Foot-and-Mouth Disease
Recombinant AAV Vectors for Enhanced Expression of Authentic IgG.
Fraser Syndrome
Establishment of proprotein convertase, furinA knocked-out lines in medaka, Oryzias latipes, and unique form of medaka furin-like prorprotein convertase (mflPC).
Fraser Syndrome
Genetic analysis of fin development in zebrafish identifies furin and hemicentin1 as potential novel fraser syndrome disease genes.
furin deficiency
A case of prohormone convertase deficiency diagnosed with type 2 diabetes.
furin deficiency
Both PA63 and PA83 are endocytosed within an anthrax protective antigen mixed heptamer: A putative mechanism to overcome a furin deficiency.
furin deficiency
Deficient serum furin predicts risk of abdominal obesity: findings from a prospective cohort of Chinese adults.
furin deficiency
Differential Effects of Furin Deficiency on Insulin Receptor Processing and Glucose Control in Liver and Pancreatic ? Cells of Mice.
furin deficiency
Furin deficiency in myeloid cells leads to attenuated revascularization in a mouse-model of oxygen-induced retinopathy.
Gastrinoma
Proprotein-Processing Endoprotease Furin and its Substrate Parathyroid Hormone-Related Protein Are Coexpressed in Insulinoma Cells.
Gingivitis
[Comparative clinical results in the treatment of gingivitis catarrhalis chronica with Furin M, applied by a tray for retention of the drug and by mouth rinsing]
Glioblastoma
Inhibition of furin-mediated processing results in suppression of astrocytoma cell growth and invasiveness.
Glioblastoma
Reoxygenation of hypoxic glioblastoma multiforme cells potentiates the killing effect of an interleukin-13-based cytotoxin.
Glioma
?1,6 GlcNAc branches-modified protein tyrosine phosphatase Mu attenuates its tyrosine phosphatase activity and promotes glioma cell migration through PLC?-PKC pathways.
Glioma
Opposite roles of furin and PC5A in N-cadherin processing.
Glioma
Processing of immunosuppressive pro-TGF-beta 1,2 by human glioblastoma cells involves cytoplasmic and secreted furin-like proteases.
Glucose Intolerance
Proprotein convertase furin regulates osteocalcin and bone endocrine function.
Head and Neck Neoplasms
Increased furin activity enhances the malignant phenotype of human head and neck cancer cells.
Head and Neck Neoplasms
Sheddase Activity of Tumor Necrosis Factor-{alpha} Converting Enzyme Is Increased and Prognostically Valuable in Head and Neck Cancer.
Heart Failure
Differential expression of the pro-natriuretic peptide convertases corin and furin in experimental heart failure and atrial fibrosis.
Heart Failure
Post-transcriptional modification of pro-BNP in heart failure: is glycosylation and circulating furin key for cardiovascular homeostasis?
Heart Failure
Post-translational modifications enhance NT-proBNP and BNP production in acute decompensated heart failure.
Heart Failure
Pro-B-type natriuretic peptide is cleaved intracellularly: impact of distance between O-glycosylation and cleavage sites.
Heart Failure
Pulmonary, cardiac and renal distribution of ACE2, furin, TMPRSS2 and ADAM17 in rats with heart failure: Potential implication for COVID-19 disease.
Hemochromatosis
Regulation of prohepcidin processing and activity by the subtilisin-like proprotein convertases Furin, PC5, PACE4 and PC7.
Hemophilia A
Circumventing furin enhances factor VIII biological activity and ameliorates bleeding phenotypes in hemophilia models.
Hemophilia A
Novel factor VIII variants with a modified furin cleavage site improve the efficacy of gene therapy for hemophilia A.
Hemophilia A
Stable expression of native Coagulation factor VIII using the 2A self-processing sequence and furin cleavage site.
Hemorrhagic Fever, Crimean
Recovery of Recombinant Crimean Congo Hemorrhagic Fever Virus Reveals a Function for Non-structural Glycoproteins Cleavage by Furin.
Hemorrhagic Fever, Ebola
Ebola virus envelope glycoprotein derived peptide in human Furin-bound state: computational studies.
Hemorrhagic Fever, Ebola
Reverse genetics demonstrates that proteolytic processing of the Ebola virus glycoprotein is not essential for replication in cell culture.
Hepatitis
Cleavage inhibition of the murine coronavirus spike protein by a furin-like enzyme affects cell-cell but not virus-cell fusion.
Hepatitis B
Characterization of genotype-specific carboxyl-terminal cleavage sites of hepatitis B virus e antigen precursor and identification of furin as the candidate enzyme.
Hepatitis B
Entecavir combined with furin inhibitor simultaneously reduces hepatitis B virus replication and e antigen secretion.
Hepatitis B
Furin mRNA expression in peripheral blood correlates with chronic hepatitis B virus infection.
Hepatitis B
Influence of a single nucleotide polymorphism in the P1 promoter of the furin gene on transcription activity and hepatitis B virus infection.
Hepatitis B
Initiation of duck hepatitis B virus infection requires cleavage by a furin-like protease.
Hepatitis B
Proteolytic processing of the hepatitis B virus e antigen precursor. Cleavage at two furin consensus sequences.
Hepatitis B
Suppression of furin by interferon-? and the impact on hepatitis B virus antigen biosynthesis in human hepatocytes.
Hepatitis B
Therapeutic potential of furin inhibitors for the chronic infection of hepatitis B virus.
Hepatitis B
[Hepatitis B virus-mediated effects on host expression of the proprotein convertase Furin].
Hepatitis B, Chronic
Entecavir combined with furin inhibitor simultaneously reduces hepatitis B virus replication and e antigen secretion.
Hepatitis B, Chronic
Furin mRNA expression in peripheral blood correlates with chronic hepatitis B virus infection.
Hepatitis C
Hepatitis C virus-induced furin and thrombospondin-1 activate TGF-?1: Role of TGF-?1 in HCV replication.
Hereditary Sensory and Autonomic Neuropathies
A third HSAN5 mutation disrupts the nerve growth factor furin cleavage site.
Herpes Zoster
Conserved furin cleavage site not essential for secretion and integration of ZP3 into the extracellular egg coat of transgenic mice.
Herpes Zoster
Extreme positive selection on a new highly-expressed larval glycoprotein (LGP) gene in Galaxias fishes (Osmeriformes: Galaxiidae).
Herpes Zoster
Mouse zona pellucida glycoproteins mZP2 and mZP3 undergo carboxy-terminal proteolytic processing in growing oocytes.
Herpes Zoster
Proteolytic processing of human zona pellucida proteins.
Herpes Zoster
The Human Egg's Zona Pellucida.
HIV Infections
Soluble T Cell Immunoglobulin Mucin Domain 3 Is Shed from CD8+ T Cells by the Sheddase ADAM10, Is Increased in Plasma during Untreated HIV Infection, and Correlates with HIV Disease Progression.
Hodgkin Disease
Role of ADAM10 as a CD30 Sheddase in Classical Hodgkin Lymphoma.
Hodgkin Disease
Specific ADAM10 inhibitors localize in exosome-like vesicles released by Hodgkin lymphoma and stromal cells and prevent sheddase activity carried to bystander cells.
Huntington Disease
Decreased hypothalamic prohormone convertase expression in huntington disease patients.
Hypercholesterolemia
[Relationship between genetic variation of furin gene and hypercholesterolemia and hyper-low-density lipoprotein cholesterolemia in Kazakh general population].
Hyperkalemia
How SARS-CoV-2 might affect potassium balance via impairing epithelial sodium channels?
Hypertension
Altered serum soluble furin and prorenin receptor levels in pregnancies with pre-eclampsia and fetal growth restriction.
Hypertension
Association of Rs2071410 on Furin with Transient Ischemic Attack Susceptibility and Prognosis in a Chinese Population.
Hypertension
Associations between genetic variations in the FURIN gene and hypertension.
Hypertension
Furin Protease: From SARS CoV-2 to Anthrax, Diabetes, and Hypertension.
Hypertension
FURIN variant associations with postexercise hypotension are intensity and race dependent.
Hypertension
Identification of Hub Genes Associated with Hypertension and Their Interaction with miRNA Based on Weighted Gene Coexpression Network Analysis (WGCNA) Analysis.
Hypertension
Serum furin as a biomarker of high blood pressure: findings from a longitudinal study in Chinese adults.
Hypertension
The association between paired basic amino acid cleaving enzyme 4 gene haplotype and diastolic blood pressure.
Hyperthyroidism
Thyroid hormone promotes cell invasion through activation of furin expression in human hepatoma cell lines.
Hypertriglyceridemia
Association of genetic variants with dyslipidemia.
Hypoglycemia
A case of prohormone convertase deficiency diagnosed with type 2 diabetes.
Hypoglycemia
Defective expression of prohormone convertase 4 and enhanced expression of insulin-like growth factor II by pleural solitary fibrous tumor causing hypoglycemia.
Hypophosphatemia
Osteocyte regulation of phosphate homeostasis and bone mineralization underlies the pathophysiology of the heritable disorders of rickets and osteomalacia.
Infections
A fusion-loop antibody enhances the infectious properties of immature flavivirus particles.
Infections
A monoclonal antibody against staphylococcal enterotoxin B superantigen inhibits SARS-CoV-2 entry in vitro.
Infections
A multicenter consensus: A role of furin in the endothelial tropism in obese patients with COVID-19 infection.
Infections
A toggle switch controls the low pH-triggered rearrangement and maturation of the dengue virus envelope proteins.
Infections
Accurate and efficient cleavage of the human insulin proreceptor by the human proprotein-processing protease furin. Characterization and kinetic parameters using the purified, secreted soluble protease expressed by a recombinant baculovirus.
Infections
ACE2 and Furin Expressions in Oral Epithelial Cells Possibly Facilitate COVID-19 Infection via Respiratory and Fecal-Oral Routes.
Infections
Alpha-Defensin HD5 Inhibits Furin Cleavage of Human Papillomavirus 16 L2 To Block Infection.
Infections
Antibodies against the envelope glycoprotein promote infectivity of immature dengue virus serotype 2.
Infections
Bioinformatics prediction of B and T cell epitopes within the spike and nucleocapsid proteins of SARS-CoV2.
Infections
Biological heterogeneity, including systemic replication in mice, of H5N1 influenza A virus isolates from humans in Hong Kong.
Infections
Blockage of Filoviral Glycoprotein Processing by Use of a Protein-Based Inhibitor.
Infections
Bovine respiratory syncytial virus lacking the virokinin or with a mutation in furin cleavage site RA(R/K)R109 induces less pulmonary inflammation without impeding the induction of protective immunity in calves.
Infections
Characterization of cellular furin content as a potential factor determining the susceptibility of cultured human and animal cells to coronavirus infectious bronchitis virus infection.
Infections
Cleavage and serum reactivity of the severe acute respiratory syndrome coronavirus spike protein.
Infections
Cleavage of the HPV16 Minor Capsid Protein L2 during Virion Morphogenesis Ablates the Requirement for Cellular Furin during De Novo Infection.
Infections
Cleavage of the papillomavirus minor capsid protein, L2, at a furin consensus site is necessary for infection.
Infections
Common genetic variation in humans impacts in vitro susceptibility to SARS-CoV-2 infection.
Infections
Common Genetic Variation in Humans Impacts In Vitro Susceptibility to SARS-CoV-2 Infection.
Infections
Direct role of furin in mammalian prosomatostatin processing.
Infections
Ectodomain Shedding by ADAM17: Its Role in Neutrophil Recruitment and the Impairment of This Process during Sepsis.
Infections
Efficient delivery of DNA vaccines using human papillomavirus pseudovirions.
Infections
Enzyme inhibition as a potential therapeutic strategy to treat COVID-19 infection.
Infections
Epigenetic underpinnings of inflammation: Connecting the dots between pulmonary diseases, lung cancer and COVID-19.
Infections
Expression of angiotensin-converting enzyme 2 and proteases in COVID-19 patients: A potential role of cellular FURIN in the pathogenesis of SARS-CoV-2.
Infections
Functional comparison of SARS-CoV-2 with closely related pangolin and bat coronaviruses.
Infections
Furin Cleavage of L2 during Papillomavirus Infection: Minimal Dependence on Cyclophilins.
Infections
Furin cleavage of SARS-CoV-2 Spike promotes but is not essential for infection and cell-cell fusion.
Infections
Furin Expression in Patients With Psoriasis-A Patient Cohort Endangered to SARS-COV2?
Infections
Furin is an endogenous regulator of alpha-secretase associated APP processing.
Infections
Furin mRNA expression in peripheral blood correlates with chronic hepatitis B virus infection.
Infections
FurinDB: A Database of 20-Residue Furin Cleavage Site Motifs, Substrates and Their Associated Drugs.
Infections
Genetic Control of Human Infection with SARS-CoV-2.
Infections
Heparan sulfate-independent cell binding and infection with furin-precleaved papillomavirus capsids.
Infections
Host cell entry of Middle East respiratory syndrome coronavirus after two-step, furin-mediated activation of the spike protein.
Infections
Immune Interaction Map of Human SARS-CoV-2 Target Genes: Implications for Therapeutic Avenues.
Infections
Impact of inhibitors and L2 antibodies upon the infectivity of diverse alpha and beta human papillomavirus types.
Infections
Increased susceptibility of SARS-CoV2 infection on oral cancer patients; cause and effects: An hypothesis.
Infections
Influence of a single nucleotide polymorphism in the P1 promoter of the furin gene on transcription activity and hepatitis B virus infection.
Infections
Initiation of duck hepatitis B virus infection requires cleavage by a furin-like protease.
Infections
Loss of furin cleavage site attenuates SARS-CoV-2 pathogenesis.
Infections
Membrane type-1 matrix metalloproteinase (MT1-MMP) protects malignant cells from tumoricidal activity of re-engineered anthrax lethal toxin.
Infections
Peptidomimetic furin inhibitor MI-701 in combination with oseltamivir and ribavirin efficiently blocks propagation of highly pathogenic avian influenza viruses and delays high level oseltamivir resistance in MDCK cells.
Infections
Phytopharmaceuticals mediated Furin and TMPRSS2 receptor blocking: can it be a potential therapeutic option for Covid-19?
Infections
Polyarginine inhibits gp160 processing by furin and suppresses productive human immunodeficiency virus type 1 infection.
Infections
Preparation and properties of a papillomavirus infectious intermediate and its utility for neutralization studies.
Infections
Production of Furin-Cleaved Papillomavirus Pseudovirions and Their Use for In Vitro Neutralization Assays of L1- or L2-Specific Antibodies.
Infections
Proteolytic activation of tick-borne encephalitis virus by furin.
Infections
Proteolytic processing of human cytomegalovirus glycoprotein B (gpUL55) is mediated by the human endoprotease furin.
Infections
Proteolytic processing of the Cryptosporidium glycoprotein gp40/15 by human furin and by a parasite-derived furin-like protease activity.
Infections
Recombinant Sendai viruses expressing fusion proteins with two furin cleavage sites mimic the syncytial and receptor-independent infection properties of respiratory syncytial virus.
Infections
Role of prohormone convertases in the tissue-specific processing of proglucagon.
Infections
Saliva: What Dental Practitioners Should Know about the Role of This Biofluid in the Transmission and Diagnostic of SARS-CoV-2.
Infections
Shedding Light on COVID-19: ADAM17 the Missing Link?
Infections
Single-cell RNA sequencing of SARS-CoV-2 cell entry factors in the preconceptional human endometrium.
Infections
Suppression of furin by interferon-? and the impact on hepatitis B virus antigen biosynthesis in human hepatocytes.
Infections
Targeted infection of endothelial cells by avian influenza virus A/FPV/Rostock/34 (H7N1) in chicken embryos.
Infections
Targeting host cell proteases to prevent SARS-CoV-2 invasion.
Infections
Tetraspanin CD9 affects HPV16 infection by modulating ADAM17 activity and the ERK signalling pathway.
Infections
The old but new: Can unfractioned heparin and low molecular weight heparins inhibit proteolytic activation and cellular internalization of SARS-CoV2 by inhibition of host cell proteases?
Infections
The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
Infections
The Proprotein Convertase Subtilisin/Kexin FurinA Regulates Zebrafish Host Response against Mycobacterium marinum.
Infections
The role of furin in papillomavirus infection.
Infections
The role of NH4Cl and cysteine proteases in Human Papillomavirus type 16 infection.
Infections
Therapeutic potential of furin inhibitors for the chronic infection of hepatitis B virus.
Infections
Type-2 diabetes, a co-morbidity in Covid-19: does insulin signaling matter?
Infections
Vimentin Modulates Infectious Internalization of Human Papillomavirus 16 Pseudovirions.
Infections
X-ray Structures of Human Furin in Complex with Competitive Inhibitors.
Infections
[Hepatitis B virus-mediated effects on host expression of the proprotein convertase Furin].
Infections
[Protease-dependent virus tropism and pathogenicity: The role for TMPRSS2].
Infections
[Study on a putative, proprotein convertase-cleaved product of HBV core protein in vitro].
Infertility
Oocyte-specific deletion of furin leads to female infertility by causing early secondary follicle arrest in mice.
Infertility, Female
Oocyte-specific deletion of furin leads to female infertility by causing early secondary follicle arrest in mice.
Inflammatory Bowel Diseases
High Expression of the "A Disintegrin And Metalloprotease" 19 (ADAM19), a Sheddase for TNF-? in the Mucosa of Patients with Inflammatory Bowel Diseases.
Influenza in Birds
A novel activation mechanism of avian influenza virus H9N2 by furin.
Influenza in Birds
Combined QM/MM mechanistic study of the acylation process in furin complexed with the H5N1 avian influenza virus hemagglutinin's cleavage site.
Influenza in Birds
Crystal structure of inhibitor-bound human MSPL that can activate high pathogenic avian influenza.
Influenza in Birds
Design and Structure-Activity Relationship of a Potent Furin Inhibitor Derived from Influenza Hemagglutinin.
Influenza in Birds
Effects of magnesium ions on recombinant human furin: selective activation of hydrolytic activity upon substrates derived from virus envelope glycoprotein.
Influenza in Birds
Identification of inhibitors using a cell-based assay for monitoring Golgi-resident protease activity.
Influenza in Birds
Influenza virus hemagglutinin with multibasic cleavage site is activated by furin, a subtilisin-like endoprotease.
Influenza in Birds
Inhibition of furin-mediated cleavage activation of HIV-1 glycoprotein gp160.
Influenza in Birds
Inhibition of furin/PC-catalyzed surface and intracellular processing by small molecules.
Influenza in Birds
Maturation of the trans-Golgi network protease furin: compartmentalization of propeptide removal, substrate cleavage, and COOH-terminal truncation.
Influenza in Birds
Novel type II transmembrane serine proteases, MSPL and TMPRSS13, Proteolytically activate membrane fusion activity of the hemagglutinin of highly pathogenic avian influenza viruses and induce their multicycle replication.
Influenza in Birds
Peptidomimetic furin inhibitor MI-701 in combination with oseltamivir and ribavirin efficiently blocks propagation of highly pathogenic avian influenza viruses and delays high level oseltamivir resistance in MDCK cells.
Influenza in Birds
Processing of viral glycoproteins by the subtilisin-like endoprotease furin and its inhibition by specific peptidylchloroalkylketones.
Influenza in Birds
Proprotein-processing endoproteases PC6 and furin both activate hemagglutinin of virulent avian influenza viruses.
Influenza in Birds
Protein display by bovine herpesvirus type 1 glycoprotein B.
Influenza in Birds
Role of host cellular proteases in the pathogenesis of influenza and influenza-induced multiple organ failure.
Influenza in Birds
Selective and potent furin inhibitors protect cells from anthrax without significant toxicity.
Influenza in Birds
Sequence specificity of furin, a proprotein-processing endoprotease, for the hemagglutinin of a virulent avian influenza virus.
Influenza in Birds
Source of high pathogenicity of an avian influenza virus H5N1: why H5 is better cleaved by furin.
Influenza in Birds
Targeting host cell furin proprotein convertases as a therapeutic strategy against bacterial toxins and viral pathogens.
Influenza in Birds
Two independent targeting signals in the cytoplasmic domain determine trans-Golgi network localization and endosomal trafficking of the proprotein convertase furin.
Influenza in Birds
[Protease-dependent virus tropism and pathogenicity: The role for TMPRSS2].
Influenza, Human
A mono phenylalanine-based motif (F790) and a leucine-dependent motif (LI760) mediate internalization of furin.
Influenza, Human
A study of human furin specificity using synthetic peptides derived from natural substrates, and effects of potassium ions.
Influenza, Human
Activation of an influenza virus A/turkey/Oregon/71 HA insertion variant by the subtilisin-like endoprotease furin.
Influenza, Human
Biological heterogeneity, including systemic replication in mice, of H5N1 influenza A virus isolates from humans in Hong Kong.
Influenza, Human
Design and Structure-Activity Relationship of a Potent Furin Inhibitor Derived from Influenza Hemagglutinin.
Influenza, Human
Human microRNA-24 modulates highly pathogenic avian-origin H5N1 influenza A virus infection in A549 cells by targeting secretory pathway furin.
Influenza, Human
Identification and characterization of spodoptera frugiperda furin: a thermostable subtilisin-like endopeptidase.
Influenza, Human
Implication of the proprotein convertases furin, PC5 and PC7 in the cleavage of surface glycoproteins of Hong Kong, Ebola and respiratory syncytial viruses: a comparative analysis with fluorogenic peptides.
Influenza, Human
Influenza virus hemagglutinin with multibasic cleavage site is activated by furin, a subtilisin-like endoprotease.
Influenza, Human
Maturation of HIV envelope glycoprotein precursors by cellular endoproteases.
Influenza, Human
Optimization of furin inhibitors to protect against the activation of influenza hemagglutinin H5 and Shiga toxin.
Influenza, Human
Synthesis of tight binding inhibitors and their action on the proprotein-processing enzyme furin.
Influenza, Human
The H5N1 influenza variant Fujian-like hemagglutinin selected following vaccination exhibits a compromised furin cleavage : neurological Consequences of highly pathogenic Fujian H5N1 strains.
Influenza, Human
X-ray Structures of Human Furin in Complex with Competitive Inhibitors.
Influenza, Human
[Protease-dependent virus tropism and pathogenicity: The role for TMPRSS2].
Insulin Resistance
Discovery of a possible role of asprosin in ovarian follicular function.
Insulin Resistance
[Relationship between genetic variation of Furin and insulin resistance in Chinese Kazakh population].
Insulinoma
Biosynthesis of the prohormone convertase PC2 in Chinese hamster ovary cells and in rat insulinoma cells.
Insulinoma
Isolation of two complementary deoxyribonucleic acid clones from a rat insulinoma cell line based on similarities to Kex2 and furin sequences and the specific localization of each transcript to endocrine and neuroendocrine tissues in rats.
Insulinoma
Proprotein-Processing Endoprotease Furin and its Substrate Parathyroid Hormone-Related Protein Are Coexpressed in Insulinoma Cells.
Insulinoma
Role of furin in granular acidification in the endocrine pancreas: identification of the V-ATPase subunit Ac45 as a candidate substrate.
Iron Deficiencies
Furin-mediated release of soluble hemojuvelin: a new link between hypoxia and iron homeostasis.
Iron Deficiencies
In Vivo Analysis of the Contribution of Proprotein Convertases to the Processing of FGF23.
Iron Overload
Effect of iron overload on furin expression in wild-type and ?-thalassemic mice.
Iron Overload
Hemojuvelin Modulates Iron Stress During Acute Kidney Injury: Improved by Furin Inhibitor.
Ischemic Attack, Transient
Association of Rs2071410 on Furin with Transient Ischemic Attack Susceptibility and Prognosis in a Chinese Population.
Kidney Neoplasms
The significance of TRIP11 and T3 signalling pathway in renal cancer progression and survival of patients.
Kidney Neoplasms
The transcription factor PAX2 regulates ADAM10 expression in renal cell carcinoma.
Laryngeal Neoplasms
Radiotherapy-associated Furin Expression and Tumor Invasiveness in Recurrent Laryngeal Cancer.
Leukemia
A meta-analysis of comorbidities in COVID-19: Which diseases increase the susceptibility of SARS-CoV-2 infection?
Leukemia
Aberrant expression of functional BAFF-system receptors by malignant B-cell precursors impacts leukemia cell survival.
Leukemia
Artificially controlled aggregation of proteins and targeting in hematopoietic cells.
Leukemia
Furin cleavage of the Moloney murine leukemia virus Env precursor reorganizes the spike structure.
Leukemia
Furin cleavage potentiates the membrane fusion-controlling intersubunit disulfide bond isomerization activity of leukemia virus Env.
Leukemia
The cytoplasmic domain mediates localization of furin to the trans-Golgi network en route to the endosomal/lysosomal system.
Liver Neoplasms
Furin overexpression suppresses tumor growth and predicts a better postoperative disease-free survival in hepatocellular carcinoma.
Lung Neoplasms
A meta-analysis of comorbidities in COVID-19: Which diseases increase the susceptibility of SARS-CoV-2 infection?
Lung Neoplasms
Elevated furin expression in aggressive human head and neck tumors and tumor cell lines.
Lung Neoplasms
Epigenetic underpinnings of inflammation: Connecting the dots between pulmonary diseases, lung cancer and COVID-19.
Lung Neoplasms
Prohormone convertase and autocrine growth factor mRNAs are coexpressed in small cell lung carcinoma.
Lung Neoplasms
Proprotein convertase furin in SARS-CoV-2 and non-small cell lung cancer.
Lung Neoplasms
Proprotein convertases: "master switches" in the regulation of tumor growth and progression.
Lupus Erythematosus, Systemic
Proprotein convertase enzyme FURIN is upregulated in primary Sjögren's syndrome.
Lymphoma
Stress immunity in lymphomas: mesenchymal cells as a target of therapy.
Malaria
Immunization against a merozoite sheddase promotes multiple invasion of red blood cells and attenuates Plasmodium infection in mice.
Malaria
Molecular Determinants for Subcellular Trafficking of the Malarial Sheddase PfSUB2.
Malaria
Molecular identification of a malaria merozoite surface sheddase.
Malaria
The malaria parasite sheddase SUB2 governs host red blood cell membrane sealing at invasion.
Malaria, Falciparum
Molecular Determinants for Subcellular Trafficking of the Malarial Sheddase PfSUB2.
Malnutrition
Genetic regulatory subnetworks and key regulating genes in rat hippocampus perturbed by prenatal malnutrition: implications for major brain disorders.
Marfan Syndrome
Establishment of proprotein convertase, furinA knocked-out lines in medaka, Oryzias latipes, and unique form of medaka furin-like prorprotein convertase (mflPC).
Massive Hepatic Necrosis
Influences on hepatitis B virus replication by a naturally occurring mutation in the core gene.
Measles
Effects of magnesium ions on recombinant human furin: selective activation of hydrolytic activity upon substrates derived from virus envelope glycoprotein.
Measles
Recombinant measles virus requiring an exogenous protease for activation of infectivity.
Melanoma
ADAM10 is the constitutive functional sheddase of CD44 in human melanoma cells.
Melanoma
Cumulative influence of matrix metalloproteinase-1 and -2 in the migration of melanoma cells within three-dimensional type I collagen lattices.
Melanoma
Furin processing dictates ectodomain shedding of human FAT1 cadherin.
Melanoma
Furin Prodomain ppFurin Enhances Ca2+ Entry Through Orai and TRPC6 Channels' Activation in Breast Cancer Cells.
Melanoma
Notch1 Autoactivation via Transcriptional Regulation of Furin, Which Sustains Notch1 Signaling by Processing Notch1-Activating Proteases ADAM10 and Membrane Type 1 Matrix Metalloproteinase.
Melanoma
Paired Basic Amino Acid-cleaving Enzyme 4 (PCSK6): An Emerging New Target Molecule in Human Melanoma.
Mesothelioma
ADAM10 mediates malignant pleural mesothelioma invasiveness.
Metabolic Syndrome
A multicenter consensus: A role of furin in the endothelial tropism in obese patients with COVID-19 infection.
Metabolic Syndrome
ADAM28 is elevated in humans with the metabolic syndrome and is a novel sheddase of human tumour necrosis factor-?.
Metabolic Syndrome
Association of FURIN and ZPR1 polymorphisms with metabolic syndrome.
Metabolic Syndrome
Deletion of iRhom2 protects against diet-induced obesity by increasing thermogenesis.
Mouth Neoplasms
Increased susceptibility of SARS-CoV2 infection on oral cancer patients; cause and effects: An hypothesis.
Mouth Neoplasms
Oral cancer and periodontal disease increase the risk of COVID 19? A mechanism mediated through furin and cathepsin overexpression.
Multiple Sclerosis
ACE2, TMPRSS2, and Furin variants and SARS-CoV-2 infection in Madrid, Spain.
Muscular Dystrophy, Duchenne
Mitochondrial dysfunction causes Ca2+ overload and ECM degradation-mediated muscle damage in C. elegans.
Myocardial Infarction
Co-elevation of brain natriuretic peptide and proprotein-processing endoprotease furin after myocardial infarction in rats.
Myocardial Infarction
Elevated FURIN levels in predicting mortality and cardiovascular events in patients with acute myocardial infarction.
Myocardial Infarction
Role of miR-24, Furin, and Transforming Growth Factor-?1 Signal Pathway in Fibrosis After Cardiac Infarction.
Neoplasm Metastasis
A SEMA3E mutant resistant to cleavage by furins (UNCL-SEMA3E) inhibits choroidal neovascularization.
Neoplasm Metastasis
Cancer/testis antigen-Plac1 promotes invasion and metastasis of breast cancer through Furin/NICD/PTEN signaling pathway.
Neoplasm Metastasis
Effect of Furin inhibitor on lung adenocarcinoma cell growth and metastasis.
Neoplasm Metastasis
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Neoplasm Metastasis
ERBB3-induced furin promotes the progression and metastasis of ovarian cancer via the IGF1R/STAT3 signaling axis.
Neoplasm Metastasis
Furin promotes epithelial-mesenchymal transition in pancreatic cancer cells via Hippo-YAP pathway.
Neoplasm Metastasis
FurinDB: A Database of 20-Residue Furin Cleavage Site Motifs, Substrates and Their Associated Drugs.
Neoplasm Metastasis
Implications of Proprotein Convertases in Ovarian Cancer Cell Proliferation and Tumor Progression: Insights for PACE4 as a Therapeutic Target.
Neoplasm Metastasis
Inhibition of furin by bone targeting superparamagnetic iron oxide nanoparticles alleviated breast cancer bone metastasis.
Neoplasm Metastasis
Inhibition of furin/PC-catalyzed surface and intracellular processing by small molecules.
Neoplasm Metastasis
Loss of Proprotein Convertase Furin in Mammary Gland Impairs proIGF1R and proIR Processing and Suppresses Tumorigenesis in Triple Negative Breast Cancer.
Neoplasm Metastasis
Loss of the proprotein convertase Furin in T cells represses mammary tumorigenesis in oncogene-driven triple negative breast cancer.
Neoplasm Metastasis
Potent inhibitors of furin and furin-like proprotein convertases containing decarboxylated P1 arginine mimetics.
Neoplasm Metastasis
Prodomain of the proprotein convertase subtilisin/kexin Furin (ppFurin) protects from tumor progression and metastasis.
Neoplasm Metastasis
Role of c-Src activity in the regulation of gastric cancer cell migration.
Neoplasm Metastasis
Selective inhibition of proprotein convertases represses the metastatic potential of human colorectal tumor cells.
Neoplasm Metastasis
Single Nucleotide Polymorphism (rs4932178) in the P1 Promoter of FURIN Is Not Prognostic to Colon Cancer.
Neoplasm Metastasis
The crystal structure of the proprotein processing proteinase furin explains its stringent specificity.
Neoplasm Metastasis
The mechanism of PDX in regulating cervical cancer HeLa cell proliferation and tumor formation.
Neoplasm Metastasis
The Proprotein Convertase Furin Contributes to Rhabdomyosarcoma Malignancy by Promoting Vascularization, Migration and Invasion.
Neoplasm Metastasis
Thyroid hormone promotes cell invasion through activation of furin expression in human hepatoma cell lines.
Neoplasm Metastasis
[Effects of ?1-PDX, a furin inhibitor, on growth, invasion, and tumorigenicity of cervical cancer HeLa cells].
Neoplasms
A Case of acromegaly associated with subclinical Cushing's disease.
Neoplasms
A femtomol range FRET biosensor reports exceedingly low levels of cell surface furin: implications for the processing of anthrax protective antigen.
Neoplasms
A fine-needle aspiration-based protein signature discriminates benign from malignant breast lesions.
Neoplasms
A Golgi-Targeting and Dual-Color "Turn-On" Probe for Spatially Precise Imaging of Furin.
Neoplasms
A Novel TNF-? Converting Enzyme (TACE) Selective Inhibitor JTP-96193 Prevents Insulin Resistance in KK-Ay Type 2 Diabetic Mice and Diabetic Peripheral Neuropathy in Type 1 Diabetic Mice.
Neoplasms
A pressor dose of angiotensin II has no influence on the angiotensin-converting enzyme 2 and other molecules associated with SARS-CoV-2 infection in mice.
Neoplasms
A SEMA3E mutant resistant to cleavage by furins (UNCL-SEMA3E) inhibits choroidal neovascularization.
Neoplasms
A small-molecule furin inhibitor inhibits cancer cell motility and invasiveness.
Neoplasms
Aberrant ADAM10 expression correlates with osteosarcoma progression.
Neoplasms
Activatable oligomerizable imaging agents for photoacoustic imaging of furin-like activity in living subjects.
Neoplasms
ADAM-10 and ADAM-17 in the inflamed human CNS.
Neoplasms
ADAM10 as a target for anti-cancer therapy.
Neoplasms
ADAM10 mediates malignant pleural mesothelioma invasiveness.
Neoplasms
ADAM10 Sheddase Activity is a Potential Lung-Cancer Biomarker.
Neoplasms
ADAM17 at the interface between inflammation and autoimmunity.
Neoplasms
ADAM17 deficiency by mature neutrophils has differential effects on L-selectin shedding.
Neoplasms
ADAM17 is a survival factor for microglial cells in vitro and in vivo after spinal cord injury in mice.
Neoplasms
ADAM17 Promotes Motility, Invasion, and Sprouting of Lymphatic Endothelial Cells.
Neoplasms
ADAM28 is elevated in humans with the metabolic syndrome and is a novel sheddase of human tumour necrosis factor-?.
Neoplasms
Alterations in gene expression of proprotein convertases in human lung cancer have a limited number of scenarios.
Neoplasms
Alternative pathway for the role of furin in tumor cell invasion process. Enhanced MMP-2 levels through bioactive TGFbeta.
Neoplasms
An Antibody Designed to Improve Adoptive NK-Cell Therapy Inhibits Pancreatic Cancer Progression in a Murine Model.
Neoplasms
Anthrax toxin: structures, functions and tumour targeting.
Neoplasms
Assessing experimental models in myocardial injury: Lack of activation of the proteases TACE and calpain in brief ischaemia and reperfusion.
Neoplasms
Astrocyte and endothelial cell expression of ADAM 17 (TACE) in adult human CNS.
Neoplasms
BacMam production and crystal structure of nonglycosylated apo human furin at 1.89?Å resolution.
Neoplasms
Blockade of furin activity and furin-induced tumor cells malignant phenotypes by the chemically synthesized human furin prodomain.
Neoplasms
Cancer/testis antigen-Plac1 promotes invasion and metastasis of breast cancer through Furin/NICD/PTEN signaling pathway.
Neoplasms
Case Report: Immune-mediated Complete Response in a Patient With Recurrent Advanced Ewing Sarcoma (EWS) After Vigil Immunotherapy.
Neoplasms
Cellular sheddases are induced by Merkel cell polyomavirus small tumour antigen to mediate cell dissociation and invasiveness.
Neoplasms
Colorectal cancer cells express functional cell surface-bound TGFbeta.
Neoplasms
Comparative analysis of expression of the proprotein convertases furin, PACE4, PC1 and PC2 in human lung tumours.
Neoplasms
Construction and characterization of novel, recombinant immunotoxins targeting the Her2/neu oncogene product: in vitro and in vivo studies.
Neoplasms
Control of spontaneous ovarian tumors by CD8+ T cells through NKG2D-targeted delivery of antigenic peptide.
Neoplasms
Controlled intracellular self-assembly of gadolinium nanoparticles as smart molecular MR contrast agents.
Neoplasms
COVID-19 and cancer: Sailing through the tides.
Neoplasms
Cytotoxic activity of immunotoxin SS1P is modulated by TACE-dependent mesothelin shedding.
Neoplasms
Deciphering the Role of the ADAM17-Dependent Secretome in Cell Signaling.
Neoplasms
Decreased TNF Levels and Improved Retinal Ganglion Cell Survival in MMP-2 Null Mice Suggest a Role for MMP-2 as TNF Sheddase.
Neoplasms
Defective expression of prohormone convertase 4 and enhanced expression of insulin-like growth factor II by pleural solitary fibrous tumor causing hypoglycemia.
Neoplasms
Deletion of iRhom2 protects against diet-induced obesity by increasing thermogenesis.
Neoplasms
Detection of a soluble form of CD109 in serum of CD109 transgenic and tumor xenografted mice.
Neoplasms
Discovery of a potent, selective, and orally active human epidermal growth factor receptor-2 sheddase inhibitor for the treatment of cancer.
Neoplasms
Distribution and colocalization of cholecystokinin with the prohormone convertase enzymes PC1, PC2, and PC5 in rat brain.
Neoplasms
Ectodomain shedding of furin: kinetics and role of the cysteine-rich region.
Neoplasms
ELA/APELA precursor cleaved by furin displays tumor suppressor function in renal cell carcinoma through mTORC1 activation.
Neoplasms
Elevated furin expression in aggressive human head and neck tumors and tumor cell lines.
Neoplasms
Endoproteolysis of beta-secretase (beta-site amyloid precursor protein-cleaving enzyme) within its catalytic domain. A potential mechanism for regulation.
Neoplasms
Endoproteolytic processing of proopiomelanocortin and prohormone convertases 1 and 2 in neuroendocrine cells overexpressing prohormone convertases 1 or 2.
Neoplasms
Engineering of ?1-antitrypsin variants with improved specificity for the proprotein convertase furin using site-directed random mutagenesis.
Neoplasms
Engineering of alpha1-antitrypsin variants selective for subtilisin-like proprotein convertases PACE4 and PC6: importance of the P2' residue in stable complex formation of the serpin with proprotein convertase.
Neoplasms
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Neoplasms
Enzyme-instructed self-aggregation of Fe3O4 nanoparticles for enhanced MRI T2 imaging and photothermal therapy of tumors.
Neoplasms
Epigenetic underpinnings of inflammation: Connecting the dots between pulmonary diseases, lung cancer and COVID-19.
Neoplasms
Epithelial Cell-Derived a Disintegrin and Metalloproteinase-17 Confers Resistance to Colonic Inflammation Through EGFR Activation.
Neoplasms
ERBB3-induced furin promotes the progression and metastasis of ovarian cancer via the IGF1R/STAT3 signaling axis.
Neoplasms
Establishment of an MT4-MMP-deficient mouse strain representing an efficient tracking system for MT4-MMP/MMP-17 expression in vivo using beta-galactosidase.
Neoplasms
Expression of angiotensin-converting enzyme 2 and proteases in COVID-19 patients: A potential role of cellular FURIN in the pathogenesis of SARS-CoV-2.
Neoplasms
Expression of microRNA-21 and TIMP-3 in paradoxical psoriasiform reactions during treatment with antitumor necrosis factor agents.
Neoplasms
Expression of the prohormone convertase PC2 correlates with the presence of corticotropin-like intermediate lobe peptide in human adrenocorticotropin-secreting tumors.
Neoplasms
Full-Length Semaphorin-3C Is an Inhibitor of Tumor Lymphangiogenesis and Metastasis.
Neoplasms
Functionally confirmed compound heterozygous ADAM17 missense loss-of-function variants cause neonatal inflammatory skin and bowel disease 1.
Neoplasms
FURIN correlated with immune infiltration serves as a potential biomarker in SARS-CoV-2 infection-related lung adenocarcinoma.
Neoplasms
Furin Enzyme and pH Synergistically Triggered Aggregation of Gold Nanoparticles for Activated Photoacoustic Imaging and Photothermal Therapy of Tumors.
Neoplasms
Furin expression in squamous cell carcinomas of the oral cavity and other sites evaluated by tissue microarray technology.
Neoplasms
Furin inhibition results in absent or decreased invasiveness and tumorigenicity of human cancer cells.
Neoplasms
Furin inhibitor D6R suppresses epithelial-mesenchymal transition in SW1990 and PaTu8988 cells via the Hippo-YAP signaling pathway.
Neoplasms
Furin is involved in uterine activation for labor.
Neoplasms
Furin mediates brain-derived neurotrophic factor upregulation in cultured rat astrocytes exposed to oxygen-glucose deprivation.
Neoplasms
Furin overexpression suppresses tumor growth and predicts a better postoperative disease-free survival in hepatocellular carcinoma.
Neoplasms
Furin promotes epithelial-mesenchymal transition in pancreatic cancer cells via Hippo-YAP pathway.
Neoplasms
Furin regulates the intracellular activation and the uptake rate of cell surface-associated MT1-MMP.
Neoplasms
Furin targeted drug delivery for treatment of rhabdomyosarcoma in a mouse model.
Neoplasms
Furin-mediated processing of Pro-C-type natriuretic peptide.
Neoplasms
Furin-mediated protein processing in infectious diseases and cancer.
Neoplasms
FurinDB: A Database of 20-Residue Furin Cleavage Site Motifs, Substrates and Their Associated Drugs.
Neoplasms
Gemogenovatucel-T (Vigil) immunotherapy as maintenance in frontline stage III/IV ovarian cancer (VITAL): a randomised, double-blind, placebo-controlled, phase 2b trial.
Neoplasms
Human carcinoma cell growth and invasiveness is impaired by the propeptide of the ubiquitous proprotein convertase furin.
Neoplasms
Human furin Cys198 imposes dihedral and positional restraints on His194 for optimal Ser386-proton transfer.
Neoplasms
Hypoxia enhances cancer cell invasion through relocalization of the proprotein convertase furin from the trans-Golgi network to the cell surface.
Neoplasms
Identification of potent and compartment-selective small molecule furin inhibitors using cell-based assays.
Neoplasms
Immune Interaction Map of Human SARS-CoV-2 Target Genes: Implications for Therapeutic Avenues.
Neoplasms
Immunohistochemical expressions of prohormone convertase (PC)1/3 and PC2 in carcinoids of various organs.
Neoplasms
Impact of IGF-1R/EGFR cross-talks on hepatoma cell sensitivity to gefitinib.
Neoplasms
Implications of Proprotein Convertases in Ovarian Cancer Cell Proliferation and Tumor Progression: Insights for PACE4 as a Therapeutic Target.
Neoplasms
In situ evidence of involvement of Schwann cells in ulcerative colitis: autocrine and paracrine signaling by A disintegrin and metalloprotease-17-mediated tumor necrosis factor alpha production.
Neoplasms
In Situ Imaging of Furin Activity with a Highly Stable Probe by Releasing of Precipitating Fluorochrome.
Neoplasms
In Vivo Bioluminescence Imaging of Furin Activity in Breast Cancer Cells Using Bioluminogenic Substrates.
Neoplasms
Inactivation of proprotein convertases in T cells inhibits PD-1 expression and creates a favorable immune microenvironment in colorectal cancer.
Neoplasms
Inclusion of a Furin Cleavage Site Enhances Antitumor Efficacy against Colorectal Cancer Cells of Ribotoxin ?-Sarcin- or RNase T1-Based Immunotoxins.
Neoplasms
Increased expression of the pro-protein convertase furin predicts decreased survival in ovarian cancer.
Neoplasms
Increased furin activity enhances the malignant phenotype of human head and neck cancer cells.
Neoplasms
Inhibition of furin by bone targeting superparamagnetic iron oxide nanoparticles alleviated breast cancer bone metastasis.
Neoplasms
Inhibition of furin results in increased growth, invasiveness and cytokine production of synoviocytes from patients with rheumatoid arthritis.
Neoplasms
Inhibition of furin/PC-catalyzed surface and intracellular processing by small molecules.
Neoplasms
Inhibition of matrix metalloproteinase 2 maturation and HT1080 invasiveness by a synthetic furin inhibitor.
Neoplasms
Inhibition of processing of parathyroid hormone-related peptide by anti-sense furin: effect in vitro and in vivo on rat Leydig (H-500) tumor cells.
Neoplasms
Inhibition of Tumor Cells Proliferation and Migration by the Flavonoid Furin Inhibitor Isolated From Oroxylum indicum.
Neoplasms
Inhibition of tumor necrosis factor-alpha-converting enzyme by a selective antagonist protects brain from focal ischemic injury in rats.
Neoplasms
Inhibitory role of TACE/ADAM17 cytotail in protein ectodomain shedding.
Neoplasms
Interleukin-33 is a Novel Immunosuppressor that Protects Cancer Cells from TIL Killing by a Macrophage-Mediated Shedding Mechanism.
Neoplasms
Intracellular Disassembly of Self-Quenched Nanoparticles Turns NIR Fluorescence on for Sensing Furin Activity in Cells and in Tumors.
Neoplasms
L1 expression as a predictor of progression and survival in patients with uterine and ovarian carcinomas.
Neoplasms
Limited redundancy of the proprotein convertase furin in mouse liver.
Neoplasms
Lipoic acid-induced oxidative stress abrogates IGF-1R maturation by inhibiting the CREB/furin axis in breast cancer cell lines.
Neoplasms
Liver-Specific Inactivation of the Proprotein Convertase FURIN Leads to Increased Hepatocellular Carcinoma Growth.
Neoplasms
Loss of Proprotein Convertase Furin in Mammary Gland Impairs proIGF1R and proIR Processing and Suppresses Tumorigenesis in Triple Negative Breast Cancer.
Neoplasms
Loss of the proprotein convertase Furin in T cells represses mammary tumorigenesis in oncogene-driven triple negative breast cancer.
Neoplasms
Matrix metalloproteinase-activated anthrax lethal toxin inhibits endothelial invasion and neovasculature formation during in vitro morphogenesis.
Neoplasms
Metalloprotease-mediated GH receptor proteolysis and GHBP shedding. Determination of extracellular domain stem region cleavage site.
Neoplasms
Modifying the soil to affect the seed: role of stromal-derived matrix metalloproteinases in cancer progression.
Neoplasms
Modular Pore-Forming Immunotoxins with Caged Cytotoxicity Tailored by Directed Evolution.
Neoplasms
MT1-MMP mediates MUC1 shedding independent of TACE/ADAM17.
Neoplasms
Near-Infrared Fluorescent Furin Probe for Revealing the Role of Furin in Cellular Carcinogenesis and Specific Cancer Imaging.
Neoplasms
Notch1 Autoactivation via Transcriptional Regulation of Furin, Which Sustains Notch1 Signaling by Processing Notch1-Activating Proteases ADAM10 and Membrane Type 1 Matrix Metalloproteinase.
Neoplasms
One-step 18F-fluorination of smart positron emission tomography tracer for sensing furin activity in tumors.
Neoplasms
p38 Kinase is Crucial for Osteopontin-induced Furin Expression that Supports Cervical Cancer Progression.
Neoplasms
PACE4 is an important driver of ZR-75-1 estrogen receptor-positive breast cancer proliferation and tumor progression.
Neoplasms
Pan-Cancer Analysis of FURIN as a Potential Prognostic and Immunological Biomarker.
Neoplasms
Phase II study of Vigil® DNA engineered immunotherapy as maintenance in advanced stage ovarian cancer.
Neoplasms
Plasma levels of the proprotein convertase furin and incidence of diabetes and mortality.
Neoplasms
Polyarginines are potent furin inhibitors.
Neoplasms
Polymorphisms in the transforming growth factor beta 1 pathway in relation to colorectal cancer progression.
Neoplasms
Post-translational processing of proopiomelanocortin (POMC) in mouse pituitary melanotroph tumors induced by a POMC-simian virus 40 large T antigen transgene.
Neoplasms
Potent inhibition of tumor angiogenesis by the matrix metalloproteinase-activated anthrax lethal toxin: Implications for broad anti-tumor efficacy.
Neoplasms
Potent inhibitors of furin and furin-like proprotein convertases containing decarboxylated P1 arginine mimetics.
Neoplasms
Prediction of proprotein convertase cleavage sites.
Neoplasms
Pro-protein convertase gene expression in human breast cancer.
Neoplasms
Processing of CD109 by furin and its role in the regulation of TGF-beta signaling.
Neoplasms
Prodomain of the proprotein convertase subtilisin/kexin Furin (ppFurin) protects from tumor progression and metastasis.
Neoplasms
Proprotein convertases in post-menopausal endometrial cancer: Distinctive regulation and non-invasive diagnosis.
Neoplasms
Proprotein-Processing Endoprotease Furin and its Substrate Parathyroid Hormone-Related Protein Are Coexpressed in Insulinoma Cells.
Neoplasms
Protection of the Furin Cleavage Site in Low-Toxicity Immunotoxins Based on Pseudomonas Exotoxin A.
Neoplasms
Proteolytic processing activates a viral superantigen.
Neoplasms
Proteolytic processing of pro-opiomelanocortin occurs in acidifying secretory granules of AtT-20 cells.
Neoplasms
Radiotherapy-associated Furin Expression and Tumor Invasiveness in Recurrent Laryngeal Cancer.
Neoplasms
Reactive oxygen species mediate tumor necrosis factor alpha-converting, enzyme-dependent ectodomain shedding induced by phorbol myristate acetate.
Neoplasms
Recombinant immunoproapoptotic proteins with furin site can translocate and kill HER2-positive cancer cells.
Neoplasms
Regulation of prohepcidin processing and activity by the subtilisin-like proprotein convertases Furin, PC5, PACE4 and PC7.
Neoplasms
Relationships between serum HER2 ECD, TIMP-1 and clinical outcomes in Taiwanese breast cancer.
Neoplasms
Role for furin in tumor necrosis factor alpha-induced activation of the matrix metalloproteinase/sphingolipid mitogenic pathway.
Neoplasms
Role of proprotein convertases in prostate cancer progression.
Neoplasms
Selective cytotoxicity to HER2-positive tumor cells by a recombinant e23sFv-TD-tBID protein containing a furin cleavage sequence.
Neoplasms
Selective roles for tumor necrosis factor alpha-converting enzyme/ADAM17 in the shedding of the epidermal growth factor receptor ligand family: the juxtamembrane stalk determines cleavage efficiency.
Neoplasms
Self-Assembly of Amphiphilic Peptides for Recognizing High Furin-Expressing Cancer Cells.
Neoplasms
Sheddase Activity of Tumor Necrosis Factor-{alpha} Converting Enzyme Is Increased and Prognostically Valuable in Head and Neck Cancer.
Neoplasms
Simultaneous expression of furin and vascular endothelial growth factor in human oral tongue squamous cell carcinoma progression.
Neoplasms
Single Nucleotide Polymorphism (rs4932178) in the P1 Promoter of FURIN Is Not Prognostic to Colon Cancer.
Neoplasms
Soluble Form of the (Pro)Renin Receptor Generated by Intracellular Cleavage by Furin Is Secreted in Plasma.
Neoplasms
Substitution of methionine 435 with leucine, isoleucine, and serine in tumor necrosis factor alpha converting enzyme inactivates ectodomain shedding activity.
Neoplasms
Synergistic inhibition with a dual epidermal growth factor receptor/HER-2/neu tyrosine kinase inhibitor and a disintegrin and metalloprotease inhibitor.
Neoplasms
Synthetic small molecule furin inhibitors derived from 2,5-dideoxystreptamine.
Neoplasms
T-cell-expressed proprotein convertase FURIN inhibits DMBA/TPA-induced skin cancer development.
Neoplasms
TACE (ADAM17) inhibits Schwann cell myelination.
Neoplasms
TACE in perinatal mouse lung epithelial cells promotes lung saccular formation.
Neoplasms
TACE/ADAM17 Mediates Mechanotransduction in Murine Tracheal Epithelial Cells.
Neoplasms
Targeted Coating With Antigenic Peptide Renders Tumor Cells Susceptible to CD8(+) T Cell-mediated Killing.
Neoplasms
Targeted delivery of activatable fluorescent probe for detection of furin activity in living cells.
Neoplasms
Targeted truncation of the ADAM17 cytoplasmic domain in mice results in protein destabilization and a hypomorphic phenotype.
Neoplasms
Targeting ADAM17 Sheddase Activity In Cancer.
Neoplasms
Targeting of tumor cells by cell surface urokinase plasminogen activator-dependent anthrax toxin.
Neoplasms
Targeting proprotein convertases in furin-rich lung cancer cells results in decreased in vitro and in vivo growth.
Neoplasms
Targeting the membrane-anchored serine protease testisin with a novel engineered anthrax toxin prodrug to kill tumor cells and reduce tumor burden.
Neoplasms
The crystal structure of the proprotein processing proteinase furin explains its stringent specificity.
Neoplasms
The growth hormone receptor interacts with its sheddase, the tumour necrosis factor-alpha-converting enzyme (TACE).
Neoplasms
The mechanism of PDX in regulating cervical cancer HeLa cell proliferation and tumor formation.
Neoplasms
The membrane-proximal domain of ADAM17 represents the putative molecular switch of its shedding activity operated by protein-disulfide isomerase.
Neoplasms
The Proprotein Convertase Furin Contributes to Rhabdomyosarcoma Malignancy by Promoting Vascularization, Migration and Invasion.
Neoplasms
The proprotein convertase furin in tumour progression.
Neoplasms
The proprotein convertase furin is required to maintain viability of alveolar rhabdomyosarcoma cells.
Neoplasms
The proprotein convertase PC5/6 is protective against intestinal tumorigenesis: in vivo mouse model.
Neoplasms
The Proprotein Convertase Subtilisin/Kexin FurinA Regulates Zebrafish Host Response against Mycobacterium marinum.
Neoplasms
The proprotein convertases furin and PACE4 play a significant role in tumor progression.
Neoplasms
Therapeutic potential of TACE inhibitors in stroke.
Neoplasms
Therapeutic uses of furin and its inhibitors: a patent review.
Neoplasms
Thyroid hormone promotes cell invasion through activation of furin expression in human hepatoma cell lines.
Neoplasms
TNF-alpha converting enzyme (TACE) protein expression in different clinical subtypes of multiple sclerosis.
Neoplasms
TNF?-Erk1/2 signaling pathway-regulated SerpinE1 and SerpinB2 are involved in lipopolysaccharide-induced porcine granulosa cell proliferation.
Neoplasms
Transcriptional regulation of subtilisin-like proprotein convertase PACE4 by E2F: possible role of E2F-mediated upregulation of PACE4 in tumor progression.
Neoplasms
Transgenic overexpression of the proprotein convertase furin enhances skin tumor growth.
Neoplasms
Tumor cell-selective cytotoxicity of matrix metalloproteinase-activated anthrax toxin.
Neoplasms
Tumor imaging using radiolabelled matrix metalloproteinase-activated anthrax proteins.
Neoplasms
Tumor Necrosis Factor-? Converting Enzyme (TACE) Is a Growth Hormone Binding Protein (GHBP) Sheddase: The Metalloprotease TACE/ADAM-17 Is Critical for (PMA-Induced) GH Receptor Proteolysis and GHBP Generation.
Neoplasms
Tumor necrosis factor-alpha converting enzyme (TACE) is a growth hormone binding protein (GHBP) sheddase: the metalloprotease TACE/ADAM-17 is critical for (PMA-induced) GH receptor proteolysis and GHBP generation.
Neoplasms
Tumor necrosis factor-alpha converting enzyme in the human placenta throughout gestation.
Neoplasms
Tumor necrosis factor-alpha converting enzyme/ADAM 17 mediates MUC1 shedding.
Neoplasms
Tumor necrosis factor-alpha processing inhibitor-1 inhibits skin fibrosis in a bleomycin-induced murine model of scleroderma.
Neoplasms
Tumorigenicity of cortical astrocyte cell line induced by the protease ADAM17.
Neoplasms
Tumour necrosis factor (TNF-alpha) alpha converting enzyme and soluble TNF-alpha receptor type 1 in psoriasis patients in relation to the chronic alcohol consumption.
Neoplasms
Upregulation of ADAM-17 expression in active lesions in multiple sclerosis.
Neoplasms
X-ray Structures of Human Furin in Complex with Competitive Inhibitors.
Neoplasms
[Generation and characterization of the adult neuron-specific ADAM10 knock-out mice].
Neoplasms
[Tissue collagenase MMP-14 and endogenous regulators of its activity in the corpus uteri in squamous cell carcinoma of the cervix].
Nervous System Diseases
FurinDB: A Database of 20-Residue Furin Cleavage Site Motifs, Substrates and Their Associated Drugs.
Neuralgia
Effect of recombinant adenovirus coding for endomorphin-2 on neuropathic pain in rats.
Neuroblastoma
HIV-induced neuroinflammation: impact of PAR1 and PAR2 processing by Furin.
Neuroblastoma
Proteolytic processing of chromogranin A by the prohormone convertase PC2.
Neurodegenerative Diseases
Furin promotes dendritic morphogenesis and learning and memory in transgenic mice.
Neurodegenerative Diseases
Roles of endoproteolytic ?-cleavage and shedding of the prion protein in neurodegeneration.
Neurodegenerative Diseases
[Furin as proprotein convertase and its role in normaland pathological biological processes].
Neuroinflammatory Diseases
Gallic Acid is a Dual ?/?-Secretase Modulator that Reverses Cognitive Impairment and Remediates Pathology in Alzheimer Mice.
Neuroinflammatory Diseases
HIV-induced neuroinflammation: impact of PAR1 and PAR2 processing by Furin.
Newcastle Disease
Cellular CARD11 Inhibits the Fusogenic Activity of Newcastle Disease Virus via CBM Signalosome-Mediated Furin Reduction in Chicken Fibroblasts.
Non-alcoholic Fatty Liver Disease
A meta-analysis of comorbidities in COVID-19: Which diseases increase the susceptibility of SARS-CoV-2 infection?
Non-alcoholic Fatty Liver Disease
Pediatric Non-Alcoholic Fatty Liver Disease Is Affected by Genetic Variants Involved in Lifespan/Healthspan.
Obesity
A higher level of serum furin indicates a higher risk of microalbuminuria: results from a longitudinal study in Chinese adults.
Obesity
Association between circulating furin levels, obesity and pro-inflammatory markers in children.
Obesity
Common PCSK1 Haplotypes Are Associated With Obesity in the Chinese Population.
Obesity
Deficient serum furin predicts risk of abdominal obesity: findings from a prospective cohort of Chinese adults.
Obesity
Furin Protease: From SARS CoV-2 to Anthrax, Diabetes, and Hypertension.
Obesity
Hyperphagia and early-onset obesity due to a novel homozygous missense mutation in prohormone convertase 1/3.
Obesity
Idiopathic gonadotrophin deficiency: genetic questions addressed through phenotypic characterization.
Obesity
Impaired prohormone convertases in Cpe(fat)/Cpe(fat) mice.
Obesity
Obesity--a genetic disease of adipose tissue?
Obesity
Preferential apelin-13 production by the proprotein convertase PCSK3 is implicated in obesity.
Obesity
Proprotein convertase subtilisin/kexin type 3 promotes adipose tissue-driven macrophage chemotaxis and is increased in obesity.
Obesity
Rare genetic forms of obesity: From gene to therapy.
Obesity
Regulation of adipolin/CTRP12 cleavage by obesity.
Obesity
The role of high cholesterol in age-related COVID19 lethality.
Obesity
[Association between sequence variation of Furin gene and obesity in ethnic Kazakh from Xinjiang].
Obesity
[Monogenic forms of obesity: from mice to human]
Obesity, Abdominal
Deficient serum furin predicts risk of abdominal obesity: findings from a prospective cohort of Chinese adults.
Olfaction Disorders
The effect of coronaviruses on olfaction: systematic review.
Osteoarthritis
Proprotein convertase furin inhibits matrix metalloproteinase 13 in a TGF?-dependent manner and limits osteoarthritis in mice.
Osteoporosis
Association between circulating furin levels, obesity and pro-inflammatory markers in children.
Osteosarcoma
A furin inhibitor downregulates osteosarcoma cell migration by downregulating the expression levels of MT1-MMP via the Wnt signaling pathway.
Osteosarcoma
A novel recombinant immuno-tBid with a furin site effectively suppresses the growth of HER2-positive osteosarcoma cells in vitro.
Osteosarcoma
Aberrant ADAM10 expression correlates with osteosarcoma progression.
Ovarian Neoplasms
ERBB3-induced furin promotes the progression and metastasis of ovarian cancer via the IGF1R/STAT3 signaling axis.
Ovarian Neoplasms
Increased expression of the pro-protein convertase furin predicts decreased survival in ovarian cancer.
Ovarian Neoplasms
Novel cooperative pathway of c-Myc and Furin, a pro-protein convertase, in cell proliferation as a therapeutic target in ovarian cancers.
Ovarian Neoplasms
Proprotein convertase inhibition: Paralyzing the cell's master switches.
Overweight
Association between circulating furin levels, obesity and pro-inflammatory markers in children.
Pancreatic Neoplasms
A Soluble Form of the Giant Cadherin Fat1 Is Released from Pancreatic Cancer Cells by ADAM10 Mediated Ectodomain Shedding.
Pancreatic Neoplasms
An Antibody Designed to Improve Adoptive NK-Cell Therapy Inhibits Pancreatic Cancer Progression in a Murine Model.
Pancreatic Neoplasms
Furin promotes epithelial-mesenchymal transition in pancreatic cancer cells via Hippo-YAP pathway.
Pancreatic Neoplasms
Methyl-CpG-binding protein 2 drives the Furin/TGF-?1/Smad axis to promote epithelial-mesenchymal transition in pancreatic cancer cells.
Pancreatic Neoplasms
The non-receptor tyrosine kinase c-Src mediates the PDGF-induced association between Furin and pro-MT1-MMP in HPAC pancreatic cells.
Pancreatic Neoplasms
The tyrosine kinase c-Src directly mediates growth factor-induced Notch-1 and Furin interaction and Notch-1 activation in pancreatic cancer cells.
Papillomavirus Infections
Alcohol metabolism by oral streptococci and interaction with human papillomavirus leads to malignant transformation of oral keratinocytes.
Papillomavirus Infections
Furin Cleavage of L2 during Papillomavirus Infection: Minimal Dependence on Cyclophilins.
Papillomavirus Infections
Heparan sulfate-independent cell binding and infection with furin-precleaved papillomavirus capsids.
Papillomavirus Infections
Streptococcus endopeptidases promote HPV infection in vitro.
Papillomavirus Infections
The role of furin in papillomavirus infection.
Paralysis
Mitochondrial dysfunction causes Ca2+ overload and ECM degradation-mediated muscle damage in C. elegans.
Paramyxoviridae Infections
A monomeric uncleaved respiratory syncytial virus F antigen retains prefusion-specific neutralizing epitopes.
Paramyxoviridae Infections
Analysis of cathepsin and furin proteolytic enzymes involved in viral fusion protein activation in cells of the bat reservoir host.
Paramyxoviridae Infections
Processing of viral glycoproteins by the subtilisin-like endoprotease furin and its inhibition by specific peptidylchloroalkylketones.
Paramyxoviridae Infections
Proteolytic cleavage of wild type and mutants of the F protein of human parainfluenza virus type 3 by two subtilisin-like endoproteases, furin and Kex2.
Pemphigus
Pathogenic Epitopes of Autoantibodies in Pemphigus Reside in the Amino-Terminal Adhesive Region of Desmogleins Which Are Unmasked by Proteolytic Processing of Prosequence.
Perinatal Death
Mutant Lrp1 knock-in mice generated by recombinase-mediated cassette exchange reveal differential importance of the NPXY motifs in the intracellular domain of LRP1 for normal fetal development.
Periodontal Diseases
Oral cancer and periodontal disease increase the risk of COVID 19? A mechanism mediated through furin and cathepsin overexpression.
Periodontitis
COVID-19 and Periodontitis: A Reality to Live with.
Periodontitis
Periodontal Diseases and COVID-19: A Scoping Review.
Persistent Infection
Furin mRNA expression in peripheral blood correlates with chronic hepatitis B virus infection.
Persistent Infection
The Proprotein Convertase Subtilisin/Kexin FurinA Regulates Zebrafish Host Response against Mycobacterium marinum.
Persistent Infection
Therapeutic potential of furin inhibitors for the chronic infection of hepatitis B virus.
Pheochromocytoma
Differential expression and processing of secretogranin II in relation to the status of pheochromocytoma: implications for the production of the tumoral marker EM66.
Pheochromocytoma
PC5-A-mediated processing of pro-neurotensin in early compartments of the regulated secretory pathway of PC5-transfected PC12 cells.
Pheochromocytoma
Regulation of carboxypeptidase E by membrane depolarization in PC12 pheochromocytoma cells: comparison with mRNAs encoding other peptide- and catecholamine-biosynthetic enzymes.
Pituitary Diseases
Frequent appearance of autoantibodies against prohormone convertase 1/3 and neuroendocrine protein 7B2 in patients with nonfunctioning pituitary macroadenoma.
Pituitary Neoplasms
Distribution and regulation of proconvertases PC1 and PC2 in human pituitary adenomas.
Pituitary Neoplasms
Frequent appearance of autoantibodies against prohormone convertase 1/3 and neuroendocrine protein 7B2 in patients with nonfunctioning pituitary macroadenoma.
Pneumonia
Bovine respiratory syncytial virus lacking the virokinin or with a mutation in furin cleavage site RA(R/K)R109 induces less pulmonary inflammation without impeding the induction of protective immunity in calves.
Pneumonia
SARS-CoV-2 (COVID-19) and cystic fibrosis.
Polycystic Ovary Syndrome
Discovery of a possible role of asprosin in ovarian follicular function.
Post-Exercise Hypotension
FURIN variant associations with postexercise hypotension are intensity and race dependent.
Postural Orthostatic Tachycardia Syndrome
Proconvertase Furin Is Downregulated in Postural Orthostatic Tachycardia Syndrome.
Prader-Willi Syndrome
Deficiency in prohormone convertase PC1 impairs prohormone processing in Prader-Willi syndrome.
Pre-Eclampsia
Altered serum soluble furin and prorenin receptor levels in pregnancies with pre-eclampsia and fetal growth restriction.
Prion Diseases
The sheddase ADAM10 is a potent modulator of prion disease.
Prion Diseases
TREM2 expression in the brain and biological fluids in prion diseases.
Prostatic Neoplasms
ALCAM/CD166 Is a TGF-?-Responsive Marker and Functional Regulator of Prostate Cancer Metastasis to Bone.
Prostatic Neoplasms
The Multi-Leu peptide inhibitor discriminates between PACE4 and furin and exhibits antiproliferative effects on prostate cancer cells.
Proteinuria
The epithelial sodium channel ?-subunit is processed proteolytically in human kidney.
Psoriasis
A meta-analysis of comorbidities in COVID-19: Which diseases increase the susceptibility of SARS-CoV-2 infection?
Psoriasis
Expression of microRNA-21 and TIMP-3 in paradoxical psoriasiform reactions during treatment with antitumor necrosis factor agents.
Psoriasis
Furin Expression in Patients With Psoriasis-A Patient Cohort Endangered to SARS-COV2?
Pulmonary Disease, Chronic Obstructive
Age-dependent assessment of genes involved in cellular senescence, telomere and mitochondrial pathways in human lung tissue of smokers, COPD and IPF: Associations with SARS-CoV-2 COVID-19 ACE2-TMPRSS2-Furin-DPP4 axis.
Pulmonary Disease, Chronic Obstructive
Age-Dependent Assessment of Genes Involved in Cellular Senescence, Telomere, and Mitochondrial Pathways in Human Lung Tissue of Smokers, COPD, and IPF: Associations With SARS-CoV-2 COVID-19 ACE2-TMPRSS2-Furin-DPP4 Axis.
Pulmonary Disease, Chronic Obstructive
Dysbalance of ACE2 levels - a possible cause for severe COVID-19 outcome in COPD.
Pulmonary Edema
Is Spironolactone the Preferred Renin-Angiotensin-Aldosterone Inhibitor for Protection Against COVID-19?
Rhabdomyosarcoma
Furin targeted drug delivery for treatment of rhabdomyosarcoma in a mouse model.
Rhabdomyosarcoma
The Proprotein Convertase Furin Contributes to Rhabdomyosarcoma Malignancy by Promoting Vascularization, Migration and Invasion.
Rhabdomyosarcoma
The proprotein convertase furin in tumour progression.
Rhabdomyosarcoma, Alveolar
The proprotein convertase furin is required to maintain viability of alveolar rhabdomyosarcoma cells.
Rheumatic Diseases
The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
Sarcoma, Ewing
Case Report: Immune-mediated Complete Response in a Patient With Recurrent Advanced Ewing Sarcoma (EWS) After Vigil Immunotherapy.
Seizures
Pilocarpine-induced seizures are accompanied by a transient elevation in the messenger RNA expression of the prohormone convertase PC1 in rat hippocampus: comparison with nerve growth factor and brain-derived neurotrophic factor expression.
Sepsis
Ectodomain Shedding by ADAM17: Its Role in Neutrophil Recruitment and the Impairment of This Process during Sepsis.
Sepsis
Separating signal from noise: the challenge of identifying useful biomarkers in sepsis.
Sepsis
The Plasma Level of Proprotein Convertase FURIN in Patients with Suspected Infection in the Emergency Room: A Prospective Cohort Study.
Severe Acute Respiratory Syndrome
Age-Dependent Assessment of Genes Involved in Cellular Senescence, Telomere, and Mitochondrial Pathways in Human Lung Tissue of Smokers, COPD, and IPF: Associations With SARS-CoV-2 COVID-19 ACE2-TMPRSS2-Furin-DPP4 Axis.
Severe Acute Respiratory Syndrome
Existence of SARS-CoV-2 Entry Molecules in the Oral Cavity.
Severe Acute Respiratory Syndrome
FURIN correlated with immune infiltration serves as a potential biomarker in SARS-CoV-2 infection-related lung adenocarcinoma.
Severe Acute Respiratory Syndrome
Loss of furin cleavage site attenuates SARS-CoV-2 pathogenesis.
Severe Acute Respiratory Syndrome
The SARS-CoV-2 Transcriptome and the Dynamics of the S Gene Furin Cleavage Site in Primary Human Airway Epithelia.
Severe Acute Respiratory Syndrome
The Science Underlying COVID-19: Implications for the Cardiovascular System.
Skin Neoplasms
Enhanced UV-Induced Skin Carcinogenesis in Transgenic Mice Overexpressing Proprotein Convertases.
Skin Neoplasms
T-cell-expressed proprotein convertase FURIN inhibits DMBA/TPA-induced skin cancer development.
Small Cell Lung Carcinoma
Prohormone convertase and autocrine growth factor mRNAs are coexpressed in small cell lung carcinoma.
Solitary Fibrous Tumors
Defective expression of prohormone convertase 4 and enhanced expression of insulin-like growth factor II by pleural solitary fibrous tumor causing hypoglycemia.
Somatostatinoma
Proprotein-Processing Endoprotease Furin and its Substrate Parathyroid Hormone-Related Protein Are Coexpressed in Insulinoma Cells.
Spinal Cord Injuries
Gene expression alterations of neurotrophins, their receptors and prohormone convertases in a rat model of spinal cord contusion.
Squamous Cell Carcinoma of Head and Neck
Correction: Simultaneous Expression of Furin and Vascular Endothelial Growth Factor in Human Oral Tongue Squamous Cell Carcinoma Progression.
Squamous Cell Carcinoma of Head and Neck
Elevated furin expression in aggressive human head and neck tumors and tumor cell lines.
Squamous Cell Carcinoma of Head and Neck
Furin inhibition results in absent or decreased invasiveness and tumorigenicity of human cancer cells.
Squamous Cell Carcinoma of Head and Neck
Human carcinoma cell growth and invasiveness is impaired by the propeptide of the ubiquitous proprotein convertase furin.
Squamous Cell Carcinoma of Head and Neck
Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells.
Squamous Cell Carcinoma of Head and Neck
Simultaneous expression of furin and vascular endothelial growth factor in human oral tongue squamous cell carcinoma progression.
Squamous Cell Carcinoma of Head and Neck
Targeting the sheddase activity of ADAM17 by an anti-ADAM17 antibody D1(A12) inhibits head and neck squamous cell carcinoma cell proliferation and motility via blockage of bradykinin induced HERs transactivation.
Squamous Cell Carcinoma of Head and Neck
The proprotein convertase furin in tumour progression.
Stomach Neoplasms
Prohormone convertase furin has a role in gastric cancer cell proliferation with parathyroid hormone-related peptide in a reciprocal manner.
Stomach Neoplasms
Role of c-Src activity in the regulation of gastric cancer cell migration.
Stroke
Microarray Data Analysis of Molecular Mechanism Associated with Stroke Progression.
Stroke
Serum activity of angiotensin converting enzyme 2 is decreased in patients with acute ischemic stroke.
Tachycardia
Proconvertase Furin Is Downregulated in Postural Orthostatic Tachycardia Syndrome.
Teratocarcinoma
CCK processing by pituitary GH3 cells, human teratocarcinoma cells NT2 and hNT differentiated human neuronal cells evidence for a differentiation-induced change in enzyme expression and pro CCK processing.
Thrombosis
Ibrutinib, but not zanubrutinib, induces platelet receptor shedding of GPIb-IX-V complex and integrin ?IIb?3 in mice and humans.
Thyroid Neoplasms
Differential modulation of prohormone convertase mRNA by second messenger activators in two cholecystokinin-producing cell lines.
Toxemia
Protection against anthrax toxemia by hexa-D-arginine in vitro and in vivo.
Trauma, Nervous System
ADAM17-deficiency on microglia but not on macrophages promotes phagocytosis and functional recovery after spinal cord injury.
Triple Negative Breast Neoplasms
Loss of Proprotein Convertase Furin in Mammary Gland Impairs proIGF1R and proIR Processing and Suppresses Tumorigenesis in Triple Negative Breast Cancer.
Triple Negative Breast Neoplasms
Loss of the proprotein convertase Furin in T cells represses mammary tumorigenesis in oncogene-driven triple negative breast cancer.
Uterine Cervical Neoplasms
Identification of a Six-Gene Signature for Predicting the Overall Survival of Cervical Cancer Patients.
Uterine Cervical Neoplasms
p38 Kinase is Crucial for Osteopontin-induced Furin Expression that Supports Cervical Cancer Progression.
Uterine Cervical Neoplasms
[Effects of ?1-PDX, a furin inhibitor, on growth, invasion, and tumorigenicity of cervical cancer HeLa cells].
Vaccinia
Activation of an influenza virus A/turkey/Oregon/71 HA insertion variant by the subtilisin-like endoprotease furin.
Vaccinia
Activation of human furin precursor processing endoprotease occurs by an intramolecular autoproteolytic cleavage.
Vaccinia
Cellular processing of the nerve growth factor precursor by the mammalian pro-protein convertases.
Vaccinia
Cellular processing of the neurotrophin precursors of NT3 and BDNF by the mammalian proprotein convertases.
Vaccinia
Characterization of a secreted form of human furin endoprotease.
Vaccinia
Comparative proteolytic processing of rat prosomatostatin by the convertases PC1, PC2, furin, PACE4 and PC5 in constitutive and regulated secretory pathways.
Vaccinia
Comparison of substrate specificities against the fusion glycoprotein of virulent Newcastle disease virus between a chick embryo fibroblast processing protease and mammalian subtilisin-like proteases.
Vaccinia
Differential processing of proenkephalin by prohormone convertases 1(3) and 2 and furin.
Vaccinia
Differential processing of proglucagon by the subtilisin-like prohormone convertases PC2 and PC3 to generate either glucagon or glucagon-like peptide.
Vaccinia
Direct role of furin in mammalian prosomatostatin processing.
Vaccinia
Influenza virus hemagglutinin with multibasic cleavage site is activated by furin, a subtilisin-like endoprotease.
Vaccinia
Maturation of HIV envelope glycoprotein precursors by cellular endoproteases.
Vaccinia
Maturation of the trans-Golgi network protease furin: compartmentalization of propeptide removal, substrate cleavage, and COOH-terminal truncation.
Vaccinia
Processing of prothyrotropin-releasing hormone by the family of prohormone convertases.
Vaccinia
Proinsulin processing by the subtilisin-related proprotein convertases furin, PC2, and PC3.
Vaccinia
Proparathyroid hormone is preferentially cleaved to parathyroid hormone by the prohormone convertase furin. A mass spectrometric study.
Vaccinia
Proprotein processing activity and cleavage site selectivity of the Kex2-like endoprotease PACE4.
Vaccinia
Proprotein-processing endoproteases PC6 and furin both activate hemagglutinin of virulent avian influenza viruses.
Vaccinia
Role of prohormone convertases in pro-neuropeptide Y processing: coexpression and in vitro kinetic investigations.
Vaccinia
Sequence specificity of furin, a proprotein-processing endoprotease, for the hemagglutinin of a virulent avian influenza virus.
Vaccinia
Stretch-induced hypertrophic growth of cardiocytes and processing of brain-type natriuretic peptide are controlled by proprotein-processing endoprotease furin.
Vaccinia
The prosegments of furin and PC7 as potent inhibitors of proprotein convertases. In vitro and ex vivo assessment of their efficacy and selectivity.
Vascular Diseases
Role for furin in tumor necrosis factor alpha-induced activation of the matrix metalloproteinase/sphingolipid mitogenic pathway.
Vascular System Injuries
Proprotein convertases furin and PC5: targeting atherosclerosis and restenosis at multiple levels.
Vipoma
Proprotein-Processing Endoprotease Furin and its Substrate Parathyroid Hormone-Related Protein Are Coexpressed in Insulinoma Cells.
Viremia
The furin-S2' site in avian coronavirus plays a key role in central nervous system damage progression.
Virus Diseases
ACE2 expression is related to the interferon response in airway epithelial cells but is that functional for SARS-CoV-2 entry?
Virus Diseases
Characterization of cellular furin content as a potential factor determining the susceptibility of cultured human and animal cells to coronavirus infectious bronchitis virus infection.
Virus Diseases
Design and Structure-Activity Relationship of a Potent Furin Inhibitor Derived from Influenza Hemagglutinin.
Virus Diseases
Generation of SARS-CoV-2 Spike Pseudotyped Virus for Viral Entry and Neutralization Assays: A 1-Week Protocol.
Virus Diseases
Human microRNA-24 modulates highly pathogenic avian-origin H5N1 influenza A virus infection in A549 cells by targeting secretory pathway furin.
Virus Diseases
Identification of potent and compartment-selective small molecule furin inhibitors using cell-based assays.
Virus Diseases
Limited redundancy of the proprotein convertase furin in mouse liver.
Virus Diseases
SARS-CoV-2 (COVID-19) and cystic fibrosis.
Virus Diseases
Template-assisted rational design of peptide inhibitors of furin using the lysine fragment of the mung bean trypsin inhibitor.
Virus Diseases
The crystal structure of the proprotein processing proteinase furin explains its stringent specificity.
Virus Diseases
The Potential Role of Osteopontin and Furin in Worsening Disease Outcomes in COVID-19 Patients with Pre-Existing Diabetes.
Vitiligo
The Ca2+-Binding Capacity of Epidermal Furin Is Disrupted by H2O2-Mediated Oxidation in Vitiligo.
West Nile Fever
The infectivity of prM-containing partially mature West Nile virus does not require the activity of cellular furin-like proteases.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Denault, J.B.; Leduc, R.
Furin/PACE/SPC1: a convertase involved in exocytic and endocytic processing of precursor proteins
FEBS Lett.
379
113-116
1996
Homo sapiens
brenda
Creemers, J.W.M.; Vey, M.; Schfer, W.; Ayoubi, T.A.Y.; Roebroek, A.J.M.; Klenk, H.D.; Garten, W.; van de Ven, W.J.M.
Endoproteolytic cleavage of its propeptide is a prerequisite for efficient transport of furin out of the endoplasmic reticulum
J. Biol. Chem.
270
2695-2702
1995
Bos taurus, Homo sapiens
brenda
Molloy, S.S.; Bresnahan, P.A.; Leppla, S.H.; Klimpel, K.R.; Thomas, G.
Human furin is a calcium-dependent serine endoprotease that recognizes the sequence Arg-X-X-Arg and efficiently cleaves anthrax toxin protective antigen
J. Biol. Chem.
267
16396-16402
1992
Homo sapiens
brenda
Wuthrich, M.; Creemers, J.W.M.; van de Ven, W.J.M.; Sterchi, E.E.
Human lactase-phlorizin hydrolase is not processed by furin, PC1/PC3, PC2, PACE4 and PC5/PC6A of the family of subtilisin-like proprotein processing proteases
Biochim. Biophys. Acta
1311
199-203
1996
Homo sapiens
brenda
Jean, F.; Boudreault, A.; Basak, A.; Seidah, N.G.; Lazure, C.
Fluorescent peptidyl substrates as an aid in studying the substrate specificity of human prohormone convertase PC1 and human furin and designing a potent irreversible inhibitor
J. Biol. Chem.
270
19225-19231
1995
Homo sapiens
brenda
Milhiet, P.E.; Chevallier, S.; Corbeil, D.; Seidah, N.G.; Boileau, G.
Proteolytic processing of the alpha-subunit of rat endopeptidase-24.18 by furin
Biochem. J.
309
683-688
1995
Homo sapiens
brenda
Vidricaire, G.; Denault, J.B.; Leduc, R.
Characterization of a secreted form of human furin endoprotease
Biochem. Biophys. Res. Commun.
195
1011-1018
1993
Homo sapiens
brenda
Brakch, N.; Dettin, M.; Scarinci, C.; Seidah, N.G.; di Bello, C.
Structural investigation and kinetic characterization of potential cleavage sites of HIV GP160 by human furin and PC1
Biochem. Biophys. Res. Commun.
213
356-361
1995
Homo sapiens
brenda
Rehemtulla, A.; Kaufman, R.J.
Preferred sequence requirements for cleavage of pro-von Willebrand factor by propeptide-processing enzymes
Blood
79
2349-2355
1992
Homo sapiens, Mammalia, Mus musculus
brenda
Jean, F.; Basak, A.; DiMaio, J.; Seidah, N.G.; Lazure, C.
An internally quenched fluorogenic substrate of prohormone convertase 1 and furin leads to a potent prohormone convertase inhibitor
Biochem. J.
307
689-695
1995
Homo sapiens
brenda
Jean, F.; Basak, A.; Rondeau, N.; Benjannet, S.; Hendy, G.N.; Seidah, N.G.
Enzymic characterization of murine and human prohormone convertase-1 (mPC1 and hPC1) expressed in mammalian GH4C1 cells
Biochem. J.
292
891-900
1993
Homo sapiens, Mus musculus
brenda
Garten, W.; Hallenberger, S.; Ortmann, D.; Schaefer, W.; Vey, M.; Angliker, H.; Shaw, E.; Klenk, H.D.
Processing of viral glycoproteins by the subtilisin-like endoprotease furin and its inhibition by specific peptidylchloroalkylketones
Biochimie
76
217-225
1994
aves, Homo sapiens
brenda
Basak, A.; Lazure, C.
Synthetic peptides derived from the prosegments of proprotein convertase 1/3 and furin are potent inhibitors of both enzymes
Biochem. J.
373
231-239
2003
Homo sapiens
brenda
Komiyama, T.; Fuller, R.S.
Engineered eglin c variants inhibit yeast and human proprotein processing proteases, Kex2 and furin
Biochemistry
39
15156-15165
2000
Saccharomyces cerevisiae, Homo sapiens
brenda
Dahlen, J.R.; Jean, F.; Thomas, G.; Foster, D.C.; Kisiel, W.
Inhibition of soluble recombinant furin by human proteinase inhibitor 8
J. Biol. Chem.
273
1851-1854
1998
Homo sapiens
brenda
Krysan, D.J.; Rockwell, N.C.; Fuller, R.S.
Quantitative characterization of furin specificity. Energetics of substrate discrimination using an internally consistent set of hexapeptidyl methylcoumarinamides
J. Biol. Chem.
274
23229-23234
1999
Homo sapiens
brenda
Cameron, A.; Appel, J.; Houghten, R.A.; Lindberg, I.
Polyarginines are potent furin inhibitors
J. Biol. Chem.
275
36741-36749
2000
Homo sapiens, Mus musculus
brenda
Basak, A.; Koch, P.; Dupelle, M.; Fricker, L.D.; Devi, L.A.; Chretien, M.; Seidah, N.G.
Inhibitory specificity and potency of proSAAS-derived peptides toward proprotein convertase 1
J. Biol. Chem.
276
32720-32728
2001
Homo sapiens
brenda
Bowler, R.P.; Nicks, M.; Olsen, D.A.; Thogersen, I.B.; Valnickova, Z.; Hojrup, P.; Franzusoff, A.; Enghild, J.J.; Crapo, J.D.
Furin proteolytically processes the heparin-binding region of extracellular superoxide dismutase
J. Biol. Chem.
277
16505-16511
2002
Homo sapiens, Mus musculus, Rattus norvegicus
brenda
Opal, S.M.; Artenstein, A.W.; Cristofaro, P.A.; Jhung, J.W.; Palardy, J.E.; Parejo, N.A.; Lim, Y.P.
Inter-alpha-inhibitor proteins are endogenous furin inhibitors and provide protection against experimental anthrax intoxication
Infect. Immun.
73
5101-5105
2005
Homo sapiens
brenda
Wang, P.; Tortorella, M.; England, K.; Malfait, A.M.; Thomas, G.; Arner, E.C.; Pei, D.
Proprotein convertase furin interacts with and cleaves pro-ADAMTS4 (aggrecanase-1) in the trans-Golgi network
J. Biol. Chem.
279
15434-15440
2004
Homo sapiens
brenda
Podsiadlo, P.; Komiyama, T.; Fuller, R.S.; Blum, O.
Furin inhibition by compounds of copper and zinc
J. Biol. Chem.
279
36219-36227
2004
Homo sapiens
brenda
Kacprzak, M.M.; Peinado, J.R.; Than, M.E.; Appel, J.; Henrich, S.; Lipkind, G.; Houghten, R.A.; Bode, W.; Lindberg, I.
Inhibition of furin by polyarginine-containing peptides: nanomolar inhibition by nona-D-arginine
J. Biol. Chem.
279
36788-36794
2004
Homo sapiens
brenda
Koo, B.H.; Longpre, J.M.; Somerville, R.P.; Alexander, J.P.; Leduc, R.; Apte, S.S.
Cell-surface processing of pro-ADAMTS9 by furin
J. Biol. Chem.
281
12485-12494
2006
Homo sapiens
brenda
Anders, L.; Mertins, P.; Lammich, S.; Murgia, M.; Hartmann, D.; Saftig, P.; Haass, C.; Ullrich, A.
Furin-, ADAM 10-, and gamma-secretase-mediated cleavage of a receptor tyrosine phosphatase and regulation of beta-catenins transcriptional activity
Mol. Cell. Biol.
26
3917-3934
2006
Homo sapiens, Mus musculus
brenda
Remacle, A.G.; Rozanov, D.V.; Fugere, M.; Day, R.; Strongin, A.Y.
Furin regulates the intracellular activation and the uptake rate of cell surface-associated MT1-MMP
Oncogene
25
5648-5655
2006
Homo sapiens
brenda
Dufour, E.K.; Desilets, A.; Longpre, J.M.; Leduc, R.
Stability of mutant serpin/furin complexes: dependence on pH and regulation at the deacylation step
Protein Sci.
14
303-315
2005
Homo sapiens
brenda
Han, J.; Gu, J.; Chi, C.
Possible role of histone H1 in the regulation of furin-dependent proprotein processing
Acta Biochim. Biophys. Sin.
39
173-180
2007
Homo sapiens
brenda
Guimont, P.; Grondin, F.; Dubois, C.M.
Sox9-dependent transcriptional regulation of the proprotein convertase furin
Am. J. Physiol. Cell Physiol.
293
C172-C183
2007
Homo sapiens, Mus musculus
brenda
Kim, J.M.; Jang, S.A.; Yu, B.J.; Sung, B.H.; Cho, J.H.; Kim, S.C.
High-level expression of an antimicrobial peptide histonin as a natural form by multimerization and furin-mediated cleavage
Appl. Microbiol. Biotechnol.
78
123-130
2008
Homo sapiens
brenda
Lee, S.N.; Kacprzak, M.M.; Day, R.; Lindberg, I.
Processing and trafficking of a prohormone convertase 2 active site mutant
Biochem. Biophys. Res. Commun.
355
825-829
2007
Homo sapiens
brenda
Kurmanova, A.; Llorente, A.; Polesskaya, A.; Garred, O.; Olsnes, S.; Kozlov, J.; Sandvig, K.
Structural requirements for furin-induced cleavage and activation of Shiga toxin
Biochem. Biophys. Res. Commun.
357
144-149
2007
Homo sapiens, Mus musculus
brenda
Bonod-Bidaud, C.; Beraud, M.; Vaganay, E.; Delacoux, F.; Font, B.; Hulmes, D.J.; Ruggiero, F.
Enzymatic cleavage specificity of the proalpha1(V) chain processing analysed by site-directed mutagenesis
Biochem. J.
405
299-306
2007
Homo sapiens
brenda
Bhattacharjya, S.; Xu, P.; Wang, P.; Osborne, M.J.; Ni, F.
Conformational analyses of a partially-folded bioactive prodomain of human furin
Biopolymers
86
329-344
2007
Homo sapiens
brenda
Pesu, M.; Muul, L.; Kanno, Y.; OShea, J.J.
Proprotein convertase furin is preferentially expressed in T helper 1 cells and regulates interferon gamma
Blood
108
983-985
2006
Homo sapiens, Mus musculus
brenda
Lapierre, M.; Siegfried, G.; Scamuffa, N.; Bontemps, Y.; Calvo, F.; Seidah, N.G.; Khatib, A.M.
Opposing function of the proprotein convertases furin and PACE4 on breast cancer cells malignant phenotypes: role of tissue inhibitors of metalloproteinase-1
Cancer Res.
67
9030-9034
2007
Homo sapiens
brenda
Page, R.E.; Klein-Szanto, A.J.; Litwin, S.; Nicolas, E.; Al-Jumaily, R.; Alexander, P.; Godwin, A.K.; Ross, E.A.; Schilder, R.J.; Bassi, D.E.
Increased expression of the pro-protein convertase furin predicts decreased survival in ovarian cancer
Cell. Oncol.
29
289-299
2007
Homo sapiens
brenda
Rabah, N.; Gauthier, D.; Dikeakos, J.D.; Reudelhuber, T.L.; Lazure, C.
The C-terminal region of the proprotein convertase 1/3 (PC1/3) exerts a bimodal regulation of the enzyme activity in vitro
FEBS J.
274
3482-3491
2007
Homo sapiens
brenda
Pasquato, A.; Dettin, M.; Basak, A.; Gambaretto, R.; Tonin, L.; Seidah, N.G.; Di Bello, C.
Heparin enhances the furin cleavage of HIV-1 gp160 peptides
FEBS Lett.
581
5807-5813
2007
Homo sapiens
brenda
Wanyiri, J.W.; OConnor, R.; Allison, G.; Kim, K.; Kane, A.; Qiu, J.; Plaut, A.G.; Ward, H.D.
Proteolytic processing of the Cryptosporidium glycoprotein gp40/15 by human furin and by a parasite-derived furin-like protease activity
Infect. Immun.
75
184-192
2007
Cryptosporidium parvum, Homo sapiens
brenda
Feliciangeli, S.F.; Thomas, L.; Scott, G.K.; Subbian, E.; Hung, C.H.; Molloy, S.S.; Jean, F.; Shinde, U.; Thomas, G.
Identification of a pH sensor in the furin propeptide that regulates enzyme activation
J. Biol. Chem.
281
16108-16116
2006
Homo sapiens
brenda
Benjannet, S.; Rhainds, D.; Hamelin, J.; Nassoury, N.; Seidah, N.G.
The proprotein convertase (PC) PCSK9 is inactivated by furin and/or PC5/6A: functional consequences of natural mutations and post-translational modifications
J. Biol. Chem.
281
30561-30572
2006
Homo sapiens
brenda
Shiryaev, S.A.; Remacle, A.G.; Ratnikov, B.I.; Nelson, N.A.; Savinov, A.Y.; Wei, G.; Bottini, M.; Rega, M.F.; Parent, A.; Desjardins, R.; Fugere, M.; Day, R.; Sabet, M.; Pellecchia, M.; Liddington, R.C.; Smith, J.W.; Mustelin, T.; Guiney, D.G.; Lebl, M.; Strongin, A.Y.
Targeting host cell furin proprotein convertases as a therapeutic strategy against bacterial toxins and viral pathogens
J. Biol. Chem.
282
20847-20853
2007
Homo sapiens, Mus musculus, Mus musculus C57BL/6
brenda
Bruns, J.B.; Carattino, M.D.; Sheng, S.; Maarouf, A.B.; Weisz, O.A.; Pilewski, J.M.; Hughey, R.P.; Kleyman, T.R.
Epithelial Na+ channels are fully activated by furin- and prostasin-dependent release of an inhibitory peptide from the gamma-subunit
J. Biol. Chem.
282
6153-6160
2007
Homo sapiens, Mus musculus
brenda
Pasquato, A.; Seidah, N.G.
The H5N1 influenza variant Fujian-like hemagglutinin selected following vaccination exhibits a compromised furin cleavage: Neurological consequences of highly pathogenic Fujian H5N1 strains
J. Mol. Neurosci.
35
339-343
2008
Homo sapiens
brenda
Tellier, E.; Negre-Salvayre, A.; Bocquet, B.; Itohara, S.; Hannun, Y.A.; Salvayre, R.; Auge, N.
Role for furin in tumor necrosis factor alpha-induced activation of the matrix metalloproteinase/sphingolipid mitogenic pathway
Mol. Cell. Biol.
27
2997-3007
2007
Homo sapiens
brenda
Portela-Gomes, G.M.; Grimelius, L.; Stridsberg, M.
Prohormone convertases 1/3, 2, furin and protein 7B2 (Secretogranin V) in endocrine cells of the human pancreas
Regul. Pept.
146
117-124
2008
Homo sapiens
brenda
Follis, K.E.; York, J.; Nunberg, J.H.
Furin cleavage of the SARS coronavirus spike glycoprotein enhances cell-cell fusion but does not affect virion entry
Virology
350
358-369
2006
Homo sapiens
brenda
Komiyama, T.; Coppola, J.M.; Larsen, M.J.; van Dort, M.E.; Ross, B.D.; Day, R.; Rehemtulla, A.; Fuller, R.S.
Inhibition of furin/PC-catalyzed surface and intracellular processing by small molecules
J. Biol. Chem.
284
15729-15738
2009
Homo sapiens
brenda
Hook, V.; Funkelstein, L.; Toneff, T.; Mosier, C.; Hwang, S.R.
Human pituitary contains dual cathepsin L and prohormone convertase processing pathway components involved in converting POMC into the peptide hormones ACTH, alpha-MSH, and beta-endorphin
Endocrine
35
429-437
2009
Homo sapiens
brenda
Ikonomov, O.C.; Fligger, J.; Sbrissa, D.; Dondapati, R.; Mlak, K.; Deeb, R.; Shisheva, A.
Kinesin adapter JLP links PIKfyve to microtubule-based endosome-to-trans-Golgi network traffic of furin
J. Biol. Chem.
284
3750-3761
2009
Homo sapiens
brenda
Gagliardo, B.; Kubat, N.; Faye, A.; Jaouen, M.; Durel, B.; Deschemin, J.C.; Canonne-Hergaux, F.; Sari, M.A.; Vaulont, S.
Pro-hepcidin is unable to degrade the iron exporter ferroportin unless maturated by a furin-dependent process
J. Hepatol.
50
394-401
2009
Homo sapiens, Mus musculus
brenda
Ito, K.; Kim, K.H.; Lok, A.S.; Tong, S.
Characterization of genotype-specific carboxyl-terminal cleavage sites of hepatitis B virus e antigen precursor and identification of furin as the candidate enzyme
J. Virol.
83
3507-3517
2009
Gallus gallus, Homo sapiens
brenda
Coppola, J.M.; Bhojani, M.S.; Ross, B.D.; Rehemtulla, A.
A small-molecule furin inhibitor inhibits cancer cell motility and invasiveness
Neoplasia
10
363-370
2008
Cricetulus griseus, Homo sapiens
brenda
Huynh, T.T.; Chan, K.S.; Piva, T.J.
Effect of ultraviolet radiation on the expression of pp38MAPK and furin in human keratinocyte-derived cell lines
Photodermatol. Photoimmunol. Photomed.
25
20-29
2009
Homo sapiens
brenda
Gawlik, K.; Shiryaev, S.A.; Zhu, W.; Motamedchaboki, K.; Desjardins, R.; Day, R.; Remacle, A.G.; Stec, B.; Strongin, A.Y.
Autocatalytic activation of the furin zymogen requires removal of the emerging enzymes N-terminus from the active site
PLoS ONE
4
e5031
2009
Homo sapiens
brenda
Izidoro, M.A.; Gouvea, I.E.; Santos, J.A.; Assis, D.M.; Oliveira, V.; Judice, W.A.; Juliano, M.A.; Lindberg, I.; Juliano, L.
A study of human furin specificity using synthetic peptides derived from natural substrates, and effects of potassium ions
Arch. Biochem. Biophys.
487
105-114
2009
Homo sapiens
brenda
Parker, M.W.; Hellman, L.M.; Xu, P.; Fried, M.G.; Vander Kooi, C.W.
Furin processing of semaphorin 3F determines its anti-angiogenic activity by regulating direct binding and competition for neuropilin
Biochemistry
49
4068-4075
2010
Homo sapiens
brenda
Dragulescu-Andrasi, A.; Liang, G.; Rao, J.
In vivo bioluminescence imaging of furin activity in breast cancer cells using bioluminogenic substrates
Bioconjug. Chem.
20
1660-1666
2009
Homo sapiens, Mus musculus
brenda
Wang, F.; Ren, J.; Qiu, X.C.; Wang, L.F.; Zhu, Q.; Zhang, Y.Q.; Huan, Y.; Meng, Y.L.; Yao, L.B.; Chen, S.Y.; Xu, Y.M.; Yang, A.G.
Selective cytotoxicity to HER2-positive tumor cells by a recombinant e23sFv-TD-tBID protein containing a furin cleavage sequence
Clin. Cancer Res.
16
2284-2294
2010
Homo sapiens
brenda
Semenov, A.G.; Postnikov, A.B.; Tamm, N.N.; Seferian, K.R.; Karpova, N.S.; Bloshchitsyna, M.N.; Koshkina, E.V.; Krasnoselsky, M.I.; Serebryanaya, D.V.; Katrukha, A.G.
Processing of pro-brain natriuretic peptide is suppressed by O-glycosylation in the region close to the cleavage site
Clin. Chem.
55
489-498
2009
Homo sapiens
brenda
Basak, A.; Chen, A.; Scamuffa, N.; Mohottalage, D.; Basak, S.; Khatib, A.M.
Blockade of furin activity and furin-induced tumor cells malignant phenotypes by the chemically synthesized human furin prodomain
Curr. Med. Chem.
17
2214-2221
2010
Homo sapiens
brenda
Cousin, C.; Bracquart, D.; Contrepas, A.; Corvol, P.; Muller, L.; Nguyen, G.
Soluble form of the (pro)renin receptor generated by intracellular cleavage by furin is secreted in plasma
Hypertension
53
1077-1082
2009
Homo sapiens, Mus musculus, Rattus norvegicus
brenda
Remacle, A.G.; Gawlik, K.; Golubkov, V.S.; Cadwell, G.W.; Liddington, R.C.; Cieplak, P.; Millis, S.Z.; Desjardins, R.; Routhier, S.; Yuan, X.W.; Neugebauer, W.A.; Day, R.; Strongin, A.Y.
Selective and potent furin inhibitors protect cells from anthrax without significant toxicity
Int. J. Biochem. Cell Biol.
42
987-995
2010
Homo sapiens
brenda
Becker, G.L.; Sielaff, F.; Than, M.E.; Lindberg, I.; Routhier, S.; Day, R.; Lu, Y.; Garten, W.; Steinmetzer, T.
Potent inhibitors of furin and furin-like proprotein convertases containing decarboxylated P1 arginine mimetics
J. Med. Chem.
53
1067-1075
2010
Homo sapiens
brenda
Hagiwara, S.; Murakumo, Y.; Mii, S.; Shigetomi, T.; Yamamoto, N.; Furue, H.; Ueda, M.; Takahashi, M.
Processing of CD109 by furin and its role in the regulation of TGF-beta signaling
Oncogene
29
2181-2191
2010
Homo sapiens
brenda
Zhou, Z.; Shen, T.; Zhang, B.H.; Lv, X.Y.; Lin, H.Y.; Zhu, C.; Xue, L.Q.; Wang, H.
The proprotein convertase furin in human trophoblast: Possible role in promoting trophoblast cell migration and invasion
Placenta
30
929-938
2009
Homo sapiens
brenda
Basak, A.; Khatib, A.M.; Mohottalage, D.; Basak, S.; Kolajova, M.; Bag, S.S.; Basak, A.
A novel enediynyl peptide inhibitor of furin that blocks processing of proPDGF-A, B and proVEGF-C
PLoS ONE
4
e7700
2009
Homo sapiens
brenda
Izidoro, M.A.; Assis, D.M.; Oliveira, V.; Santos, J.A.; Juliano, M.A.; Lindberg, I.; Juliano, L.
Effects of magnesium ions on recombinant human furin: selective activation of hydrolytic activity upon substrates derived from virus envelope glycoprotein
Biol. Chem.
391
1105-1112
2010
Homo sapiens
brenda
Sielaff, F.; Than, M.E.; Bevec, D.; Lindberg, I.; Steinmetzer, T.
New furin inhibitors based on weakly basic amidinohydrazones
Bioorg. Med. Chem. Lett.
21
836-840
2011
Homo sapiens
brenda
Susan-Resiga, D.; Essalmani, R.; Hamelin, J.; Asselin, M.C.; Benjannet, S.; Chamberland, A.; Day, R.; Szumska, D.; Constam, D.; Bhattacharya, S.; Prat, A.; Seidah, N.G.
Furin is the major processing enzyme of the cardiac-specific growth factor bone morphogenetic protein 10
J. Biol. Chem.
286
22785-22794
2011
Homo sapiens
brenda
Arsenault, D.; Lucien, F.; Dubois, C.M.
Hypoxia enhances cancer cell invasion through relocalization of the proprotein convertase furin from the trans-golgi network to the cell surface
J. Cell. Physiol.
227
789-800
2012
Homo sapiens
brenda
Bourne, G.L.; Grainger, D.J.
Development and characterisation of an assay for furin activity
J. Immunol. Methods
364
101-108
2011
Homo sapiens
brenda
Hajdin, K.; DAlessandro, V.; Niggli, F.K.; Schaefer, B.W.; Bernasconi, M.
Furin targeted drug delivery for treatment of rhabdomyosarcoma in a mouse model
PLoS ONE
5
e10445
2010
Homo sapiens, Mus musculus
brenda
Presser, L.D.; Haskett, A.; Waris, G.
Hepatitis C virus-induced furin and thrombospondin-1 activate TGF-beta1: role of TGF-beta1 in HCV replication
Virology
412
284-296
2011
Homo sapiens
brenda
Dahms, S.O.; Hardes, K.; Becker, G.L.; Steinmetzer, T.; Brandstetter, H.; Than, M.E.
X-ray structures of human furin in complex with competitive inhibitors
ACS Chem. Biol.
9
1113-1118
2014
Homo sapiens (P09958), Homo sapiens
brenda
Zhou, Z.; Zhang, Q.; Lu, X.; Wang, R.; Wang, H.; Wang, Y.L.; Zhu, C.; Lin, H.Y.; Wang, H.
The proprotein convertase furin is required for trophoblast syncytialization
Cell Death Dis.
4
e593-e602
2013
Mus musculus, Homo sapiens (P09958), Homo sapiens
brenda
Tafesse, F.G.; Guimaraes, C.P.; Maruyama, T.; Carette, J.E.; Lory, S.; Brummelkamp, T.R.; Ploegh, H.L.
GPR107, a G-protein-coupled receptor essential for intoxication by Pseudomonas aeruginosa exotoxin A, localizes to the Golgi and is cleaved by furin
J. Biol. Chem.
289
24005-24018
2014
Homo sapiens (P09958), Homo sapiens
brenda
Tse, L.V.; Hamilton, A.M.; Friling, T.; Whittaker, G.R.
A novel activation mechanism of avian influenza virus H9N2 by furin
J. Virol.
88
1673-1683
2014
Gallus gallus, Homo sapiens (P09958), Homo sapiens
brenda
Fu, J.; Zhang, J.; Gong, Y.; Testa, C.L.; Klein-Szanto, A.J.
Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells
Mol. Carcinog.
54
698-706
2015
Homo sapiens (P09958), Homo sapiens
brenda
Harihar, S.; Pounds, K.M.; Iwakuma, T.; Seidah, N.G.; Welch, D.R.
Furin is the major proprotein convertase required for KISS1-to-Kisspeptin processing
PLoS ONE
9
e84958
2014
Homo sapiens (P09958)
brenda
Sjoeberg, M.; Wu, S.R.; Loeving, R.; Rantalainen, K.; Lindqvist, B.; Garoff, H.
Furin cleavage of the Moloney murine leukemia virus Env precursor reorganizes the spike structure
Proc. Natl. Acad. Sci. USA
111
6034-6039
2014
Homo sapiens (P09958)
brenda
Hada, K.; Isshiki, K.; Matsuda, S.; Yuasa, K.; Tsuji, A.
Engineering of alpha1-antitrypsin variants with improved specificity for the proprotein convertase furin using site-directed random mutagenesis
Protein Eng. Des. Sel.
26
123-131
2013
Homo sapiens (P09958)
brenda
Tay, F.P.; Huang, M.; Wang, L.; Yamada, Y.; Liu, D.X.
Characterization of cellular furin content as a potential factor determining the susceptibility of cultured human and animal cells to coronavirus infectious bronchitis virus infection
Virology
433
421-430
2012
Homo sapiens (P09958), Homo sapiens
brenda
Dahms, S.O.; Jiao, G.S.; Than, M.E.
Structural studies revealed active site distortions of human furin by a small molecule inhibitor
ACS Chem. Biol.
12
1211-1216
2017
Homo sapiens (P09958), Homo sapiens
brenda
Pearce, K.; Overton, L.; Gampe, R.; Barrett, G.; Taylor, J.; McKee, D.; Campobasso, N.; Nolte, R.; Reid, R.
BacMam production and crystal structure of nonglycosylated apo human furin at 1.89 A resolution
Acta Crystallogr. Sect. F
75
239-245
2019
Homo sapiens (P09958), Homo sapiens
brenda
Dahms, S.O.; Hardes, K.; Steinmetzer, T.; Than, M.E.
X-ray structures of the proprotein convertase furin bound with substrate analogue inhibitors reveal substrate specificity determinants beyond the S4 pocket
Biochemistry
57
925-934
2018
Homo sapiens (P09958)
brenda
Valiulyte, I.; Preitakaite, V.; Tamasauskas, A.; Kazlauskas, A.
Importance of the putative furin recognition site 742 RNRR 745 for antiangiogenic Sema3C activity in vitro
Braz. J. Med. Biol. Res.
51
e7786
2018
Homo sapiens (P09958), Homo sapiens
brenda
Ginefra, P.; Filippi, B.G.H.; Donovan, P.; Bessonnard, S.; Constam, D.B.
Compartment-specific biosensors reveal a complementary subcellular distribution of bioactive furin and PC7
Cell Rep.
22
2176-2189
2018
Homo sapiens (P09958)
brenda
Hardes, K.; Ivanova, T.; Thaa, B.; McInerney, G.M.; Klokk, T.I.; Sandvig, K.; Kuenzel, S.; Lindberg, I.; Steinmetzer, T.
Elongated and shortened peptidomimetic inhibitors of the proprotein convertase furin
ChemMedChem
12
613-620
2017
Homo sapiens (P09958)
brenda
Van Lam van, T.; Ivanova, T.; Hardes, K.; Heindl, M.R.; Morty, R.E.; Boettcher-Friebertshaeuser, E.; Lindberg, I.; Than, M.E.; Dahms, S.O.; Steinmetzer, T.
Design, synthesis, and characterization of macrocyclic inhibitors of the proprotein convertase furin
ChemMedChem
14
673-685
2019
Homo sapiens (P09958)
brenda
Ortutay, Z.; Oksanen, A.; Aittomaeki, S.; Ortutay, C.; Pesu, M.
Proprotein convertase furin regulates T cell receptor-induced transactivation
J. Leukoc. Biol.
98
73-83
2015
Homo sapiens (P09958), Homo sapiens, Mus musculus (P23188), Mus musculus
brenda
Wilbers, R.H.; Westerhof, L.B.; van Raaij, D.R.; van Adrichem, M.; Prakasa, A.D.; Lozano-Torres, J.L.; Bakker, J.; Smant, G.; Schots, A.
Co-expression of the protease furin in Nicotiana benthamiana leads to efficient processing of latent transforming growth factor-beta1 into a biologically active protein
Plant Biotechnol. J.
14
1695-1704
2016
Homo sapiens (P09958), Homo sapiens
brenda
Mamedov, T.; Musayeva, I.; Acsora, R.; Gun, N.; Gulec, B.; Mammadova, G.; Cicek, K.; Hasanova, G.
Engineering, and production of functionally active human furin in N. benthamiana plant in vivo post-translational processing of target proteins by furin in plants
PLoS ONE
14
e0213438
2019
Homo sapiens (P09958), Homo sapiens
brenda
Dahms, S.O.; Arciniega, M.; Steinmetzer, T.; Huber, R.; Than, M.E.
Structure of the unliganded form of the proprotein convertase furin suggests activation by a substrate-induced mechanism
Proc. Natl. Acad. Sci. USA
113
11196-11201
2016
Homo sapiens (P09958)
brenda