Information on EC - thrombin

for references in articles please use BRENDA:EC3.4.21.5
Word Map on EC
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:

The enzyme appears in viruses and cellular organisms

GeneOntology No.
selective cleavage of Arg-/-Gly bonds in fibrinogen to form fibrin and release fibrinopeptides A and B
show the reaction diagram
hydrolysis of peptide bond
Manually annotated by BRENDA team
Manually annotated by BRENDA team
physiological function
additional information
(Substrate) hide
(Product) hide
?=not specified
Ac-Gly-Gly-Val-Arg-7-amido-4-methylcoumarin + H2O
Ac-Gly-Gly-Val-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
Ac-Leu-Gly-Val-Arg-7-amido-4-methylcoumarin + H2O
Ac-Leu-Gly-Val-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
Ac-Nle-Thr-Leu-Arg-7-amido-4-methylcoumarin + H2O
Ac-Nle-Thr-Leu-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
Ac-Nle-Thr-Pro-Arg-7-amido-4-methylcoumarin + H2O
Ac-Nle-Thr-Pro-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
Ac-Val-Thr-Pro-Arg-7-amido-4-methylcoumarin + H2O
Ac-Val-Thr-Pro-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
activated protein C + H2O
show the reaction diagram
show the reaction diagram
Ala-Ala-Pro-Phe-4-nitroanilide + H2O
Ala-Ala-Pro-Phe + 4-nitroaniline
show the reaction diagram
synthetic chromogenic substrate
benzoyl-Arg ethyl ester + H2O
benzoyl-Arg + ethanol
show the reaction diagram
benzoyl-Arg methyl ester + H2O
benzoyl-Arg + methanol
show the reaction diagram
benzoyl-L-Arg-p-nitroanilide + H2O
benzoyl-L-Arg + p-nitroaniline
show the reaction diagram
beta-Ala-Gly-Arg-4-nitroanilide + H2O
beta-Ala-Gly-Arg + 4-nitroaniline
show the reaction diagram
chromozym TH + H2O
? + 4-nitroaniline
show the reaction diagram
D-Phe-L-pipecolyl-L-Arg-4-nitroanilide + H2O
D-Phe-L-pipecolyl-L-Arg + 4-nitroanilide
show the reaction diagram
D-Phe-L-Pro-L-Arg-4-nitroanilide + H2O
D-Phe-L-Pro-L-Arg + 4-nitroaniline
show the reaction diagram
D-Phe-L-Pro-L-Phe-4-nitroanilide + H2O
D-Phe-L-Pro-L-Phe + 4-nitroaniline
show the reaction diagram
D-Phe-Pip-Arg-4-nitroanilide + H2O
D-Phe-Pip-Arg + 4-nitroaniline
show the reaction diagram
i.e. S-2238
D-Phe-Pro-Arg-4-nitroanilide + H2O
D-Phe-Pro-Arg + 4-nitroaniline
show the reaction diagram
D-Phe-Pro-Lys-4-nitroanilide + H2O
D-Phe-Pro-Lys + 4-nitroaniline
show the reaction diagram
D-Phe-Pro-Phe-4-nitroanilide + H2O
D-Phe-Pro-Phe + 4-nitroaniline
show the reaction diagram
D-phenylalanyl-pipecolyl-L-arginine-4-nitroanilide + H2O
D-phenylalanyl-pipecolyl-L-arginine + 4-nitroaniline
show the reaction diagram
D-phenylalanyl-pipecolyl-L-arginine-4-nitroanilide + H2O
show the reaction diagram
di-L-Glu-L-Pro-L-Arg-4-nitroanilide + H2O
di-L-Glu-L-Pro-L-Arg + 4-nitroaniline
show the reaction diagram
factor V (1018) + H2O
show the reaction diagram
cleavage site is LSPR
factor V (1545) + H2O
show the reaction diagram
cleavage site is WYLR
factor V (709) + H2O
show the reaction diagram
factor V + H2O
activated factor V + ?
show the reaction diagram
factor V + H2O
factor Va + propeptide
show the reaction diagram
proteolytic activation
factor VII (1689) + H2O
show the reaction diagram
clevage site is QSPR
factor VII (372) + H2O
show the reaction diagram
cleavage site is IQIR
factor VII (740) + H2O
show the reaction diagram
factor VIII + H2O
show the reaction diagram
factor VIII + H2O
activated factor VIII + ?
show the reaction diagram
factor VIII + H2O
factor VIIIa + propeptide
show the reaction diagram
factor VIII mutant D392A/D394A + H2O
show the reaction diagram
reduction in specific activity similar to a severe hemophilia phenotype. No cleavage at R740, while cleavage at R372 is not affected
factor VIII mutant Q370E/I371P/V374F/A375S + H2O
show the reaction diagram
mutation to P3-P3' residues flanking Arg740, 98% of the activtiy with wild-type
factor VIII mutant Q370S/I371P/V374F/A375Q + H2O
show the reaction diagram
mutation to P3-P3' residues flanking Arg1689, 14% of the activtiy with wild-type
factor VIII mutant R372H + H2O
show the reaction diagram
naturally occuring mutation in hemophilia A patients. About 80fold decrease in cleavage rate compared to wild-type substrate, cleavage at H372-S373 bond
factor VIII(341-376) peptide + H2O
show the reaction diagram
cleavage of Arg372 involving exosite II, the heparin binding site
factor X + H2O
factor Xa + propeptide
show the reaction diagram
factor XI + H2O
show the reaction diagram
factor XI + H2O
activated factor XI + ?
show the reaction diagram
factor XI + H2O
factor XIa
show the reaction diagram
activation by thrombin
factor XI + H2O
factor XIa + propeptide
show the reaction diagram
proteolytic activation
factor XII + H2O
activated factor XII + ?
show the reaction diagram
factor XIII + H2O
show the reaction diagram
factor XIII + H2O
activated factor XIII + ?
show the reaction diagram
factor XIII + H2O
factor XIIIa + propeptide
show the reaction diagram
factor XIII V34L mutant + H2O
activated factor XIII V34L mutant + ?
show the reaction diagram
binding structure and interaction analysis, mutant substrate, a polymorphism exists within the activation peptide segment at the P4 position of FXIII resulting in substitution V34L, FXIII V34L occurs in approximately 30% of the human population worldwide, overview
show the reaction diagram
ferrocene-labelled tetrapeptide with a polyethylene glycol linker
show the reaction diagram
ferrocene-labelled heptapeptide with a polyethylene glycol linker
fibrin I-plasma factor XIII complex + H2O
activation peptide + fibrinopeptide B
show the reaction diagram
Fibrinogen + H2O
show the reaction diagram
fibrinogen + H2O
show the reaction diagram
fibrinogen + H2O
fibrin + ?
show the reaction diagram
fibrinogen + H2O
fibrin + fibrinoepeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen + H2O
fibrin + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen 1 + H2O
fibrin 1 + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen 2 + H2O
fibrin 2 + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen A a + H2O
show the reaction diagram
fibrinogen B b + H2O
show the reaction diagram
fibrinopeptide A + H2O
show the reaction diagram
galectin-8 + H2O
show the reaction diagram
galectin-9 + H2O
show the reaction diagram
show the reaction diagram
residues 33-41 of factor XIII with mutation V34L
show the reaction diagram
residues 33-41 of factor XIII
HD-cyclohexylglycyl-Ala-Arg-4-nitroanilide + H2O
HD-cyclohexylglycyl-Ala-Arg + 4-nitroaniline
show the reaction diagram
assay method optimization with synthetic substrate HD-cyclohexylglycyl-Ala-Arg-4-nitroanilide, overview
Meizothrombin + H2O
show the reaction diagram
cleavage of R155-S156 and R284-T285 bond
N-(4-tosyl)-Gly-L-Pro-L-Arg-4-nitroanilide + H2O
N-(4-tosyl)-Gly-L-Pro-L-Arg + 4-nitroaniline
show the reaction diagram
N-p-tosyl-Gly-Pro-Arg-4-nitroanilide + H2O
N-p-tosyl-Gly-Pro-Arg + 4-nitroaniline
show the reaction diagram
Nalpha-benzyloxycarbonyl-L-Arg 4-nitrophenyl ester + H2O
Nalpha-benzyloxycarbonyl-L-Arg + 4-nitrophenol
show the reaction diagram
Nalpha-benzyloxycarbonyl-L-Lys 4-nitrophenyl ester + H2O
Nalpha-benzyloxycarbonyl-L-Lys + 4-nitrophenol
show the reaction diagram
p-nitrophenyl-p'-(Nbeta,n-butyl-Nalpha-guanidino)benzoate + H2O
show the reaction diagram
p-nitrophenyl-p'-(Nbeta,n-hexyl-Nalpha-guanidino)benzoate + H2O
show the reaction diagram
p-nitrophenyl-p'-guanidinobenzoate + H2O
show the reaction diagram
PAR1 + H2O
show the reaction diagram
PAR1 peptide + H2O
show the reaction diagram
protease-activated receptor I peptide fragment, amino acid sequence
PAR3 + H2O
show the reaction diagram
protease-activated receptor 3
PAR4 + H2O
show the reaction diagram
Pefachrom tPa + H2O
show the reaction diagram
platelet thrombin receptor peptide + H2O
show the reaction diagram
prethrombin + H2O
show the reaction diagram
cleavage of R284-T285 bond
pro-factor XIII + H2O
factor XIII
show the reaction diagram
activation by cleavage at Arg37 leading to blood coagulation
profactor V + H2O
factor V
show the reaction diagram
human, activation, recombinant
profactor VIII + H2O
factor VIII
show the reaction diagram
human, activation, recombinant
protease-activated receptor + H2O
show the reaction diagram
protease-activated receptor + H2O
activated protease-activated receptor + ?
show the reaction diagram
protease-activated receptor 1 + H2O
show the reaction diagram
protease-activated receptor 1 + H2O
activated protease-activated receptor 1 + ?
show the reaction diagram
protease-activated receptor 3 residues 44-56 + H2O
show the reaction diagram
protease-activated receptor 4 + H2O
activated PAR-4 + ?
show the reaction diagram
the cleaved form of protease-activated receptor 3, PAR-3, acts as a cofactor for thrombin cleavage and activation of PAR-4 on murine platelets, interaction analysis of thrombin with the extracellular part of PAR-4, overview
protease-activated receptor-1 + H2O
show the reaction diagram
protease-activated receptor-1 + H2O
activated PAR-1
show the reaction diagram
i.e. PAR-1, activation, major thrombin receptor
product induces connective tissue growth factor production, a fibroblast mitogen, which promotes extracellular matrix protein production
protease-activated receptor-3 + H2O
show the reaction diagram
protease-activated receptor-4 + H2O
show the reaction diagram
protein C + H2O
show the reaction diagram
protein C + H2O
activated protein C + ?
show the reaction diagram
solvent isotope effect study
protein C zymogen + H2O
activated protein C + propeptide
show the reaction diagram
protein kinase C + H2O
show the reaction diagram
proteinase-activated receptor 1 + H2O
show the reaction diagram
alpha-thrombin may not effectively catalyze proteinase-activated receptor 1-(1-41) generation
proteinase-activated receptor 4 + H2O
show the reaction diagram
alpha-thrombin may not effectively catalyze proteinase-activated receptor 4-(1-47) generation
prothrombin + H2O
show the reaction diagram
cleavage of R155-S156 and R284-T285 bond
show the reaction diagram
S-thanatin + H2O
show the reaction diagram
S2238 + H2O
show the reaction diagram
spectrozyme TH + H2O
show the reaction diagram
spectrozyme-TH + H2O
show the reaction diagram
succinyl-AAPR-4-nitroanilide + H2O
succinyl-AAPR + 4-nitroaniline
show the reaction diagram
thrombin-activable finrinolysis inhibitor + H2O
show the reaction diagram
i.e. TAFI
thrombin-activatable fibrinolysis inhibitor + H2O
show the reaction diagram
Tosyl-Arg methyl ester + H2O
Tosyl-Arg + methanol
show the reaction diagram
tosyl-Gly-L-Pro-L-Arg-4-nitroanilide + H2O
tosyl-Gly-L-Pro-L-Arg + 4-nitroaniline
show the reaction diagram
tosyl-Gly-Pro-Arg-4-nitroanilide + H2O
tosyl-Gly-Pro-Arg + 4-nitroaniline
show the reaction diagram
transmembrane receptor PAR1 + H2O
show the reaction diagram
show the reaction diagram
residues 28-41 of factor XIII with mutation V34L
show the reaction diagram
residues 28-41 of factor XIII
UpA + H2O
show the reaction diagram
additional information
(Substrate) hide
(Product) hide
?=not specified
activated protein C + H2O
show the reaction diagram
show the reaction diagram
proteolysis of ADAMTS-13 by thrombin causes an 8fold reduction in its affinity for von Willebrand factor VWF that contributes to its loss of VWF-cleaving function, physiologic function, overview
factor V + H2O
activated factor V + ?
show the reaction diagram
factor V + H2O
factor Va + propeptide
show the reaction diagram
proteolytic activation
factor VIII + H2O
show the reaction diagram
activation by cleavage of Arg372, Arg74, and Arg1689, plays a fundamental role in the amplification of the coagulation cascade
factor VIII + H2O
activated factor VIII + ?
show the reaction diagram
factor VIII + H2O
factor VIIIa + propeptide
show the reaction diagram
proteolytic activation
factor X + H2O
factor Xa + propeptide
show the reaction diagram
factor XI + H2O
activated factor XI + ?
show the reaction diagram
factor XI + H2O
factor XIa
show the reaction diagram
activation by thrombin
factor XI + H2O
factor XIa + propeptide
show the reaction diagram
proteolytic activation
factor XII + H2O
activated factor XII + ?
show the reaction diagram
activated factor XII cross-links fibrin molecules and stabilizes the fibrin clot
factor XIII + H2O
activated factor XIII + ?
show the reaction diagram
the enzyme is involved in the coagulation cascade, overview
factor XIII + H2O
factor XIIIa + propeptide
show the reaction diagram
proteolytic activation
Fibrinogen + H2O
show the reaction diagram
fibrinogen + H2O
show the reaction diagram
fibrinogen + H2O
fibrin + ?
show the reaction diagram
fibrinogen + H2O
fibrin + fibrinoepeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen + H2O
fibrin + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen 1 + H2O
fibrin 1 + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinogen 2 + H2O
fibrin 2 + fibrinopeptide A + fibrinopeptide B
show the reaction diagram
fibrinopeptide A + H2O
show the reaction diagram
galectin-8 + H2O
show the reaction diagram
although intact isoform G8L stimulates neutrophil adhesion to substrate more efficiently than isoform G8M, the activity of isoform G8L but not that of isoform G8M decreases on thrombin digestion, overview
galectin-9 + H2O
show the reaction diagram
thrombin treatment almost completely abolishes eosinophil chemoattractant activity of isoform G9L, overview
pro-factor XIII + H2O
factor XIII
show the reaction diagram
activation by cleavage at Arg37 leading to blood coagulation
protease-activated receptor + H2O
show the reaction diagram
protease-activated receptor 1 + H2O
show the reaction diagram
protease-activated receptor 1 + H2O
activated protease-activated receptor 1 + ?
show the reaction diagram
protease-activated receptor-1 + H2O
show the reaction diagram
protease-activated receptor-1 + H2O
activated PAR-1
show the reaction diagram
i.e. PAR-1, activation, major thrombin receptor
product induces connective tissue growth factor production, a fibroblast mitogen, which promotes extracellular matrix protein production
protease-activated receptor-3 + H2O
show the reaction diagram
protease-activated receptor-4 + H2O
show the reaction diagram
protein C zymogen + H2O
activated protein C + propeptide
show the reaction diagram
protein kinase C + H2O
show the reaction diagram
proteinase-activated receptor 1 + H2O
show the reaction diagram
alpha-thrombin may not effectively catalyze proteinase-activated receptor 1-(1-41) generation
proteinase-activated receptor 4 + H2O
show the reaction diagram
alpha-thrombin may not effectively catalyze proteinase-activated receptor 4-(1-47) generation
additional information
activates, can partially substitute for Na+, binding to Asp189
50% activation at 600 mM
activates, can partially substitute for Na+, binding to Asp189
additional information
(1R)-2-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-1-cyclohexyl-2-oxoethanaminium chloride
(1R)-2-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-1-cyclopentyl-2-oxoethanaminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-1-oxobutan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-1-oxopropan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-3,3-dimethyl-1-oxobutan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-3-cyclohexyl-1-oxopropan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-3-methyl-1-oxobutan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-4,4-dimethyl-1-oxopentan-2-aminium chloride
(2R)-1-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-4-methyl-1-oxopentan-2-aminium chloride
89% inhibition at 0.01 mM
19% inhibition at 0.01 mM
76% inhibition at 0.01 mM
24% inhibition at 0.01 mM
59% inhibition at 0.01 mM
29% inhibition at 0.01 mM
30% inhibition at 0.01 mM
81% inhibition at 0.01 mM
81% inhibition at 0.01 mM
94% inhibition at 0.01 mM
88% inhibition at 0.01 mM
94% inhibition at 0.01 mM
91% inhibition at 0.01 mM
82% inhibition at 0.01 mM
50% inhibition at 0.01 mM
42% inhibition at 0.01 mM
73% inhibition at 0.01 mM
63% inhibition at 0.01 mM
5% inhibition at 0.01 mM
76% inhibition at 0.01 mM
7% inhibition at 0.01 mM
77% inhibition at 0.01 mM
46% inhibition at 0.01 mM
32% inhibition at 0.01 mM
1-(2-amino-2-cyclohexyl-acetyl)-pyrrolidine-2-carboxylic acid isobutyl-amide
1-(2-cyclohexyl-2-phenylmethanesulfonylamino-acetyl)-pyrrolidine-2-carboxylic acid methylamide
1-(3,3-diphenyl-propionyl)-pyrrolidine-2-carboxylic acid methylamide
1-[2-amino-3-(4-chloro-phenyl)-propionyl]-pyrrolidine-2-carboxylic acid methylamide
1-[3-(4-chloro-phenyl)-propionyl]-pyrrolidine-2-carboxylic acid methylamide
most effective conjugated gold nanoparticle constructed with 15 thrombin-binding aptamers, comprising TBA15 and 15 TBA29 molecules, per AuNP. These exhibit, because of their particularly flexible conformation and multivalency, an ultrahigh binding affinity toward thrombin and thus extremely high anticoagulant/inhibitory potency
2-[(2S)-2-[(3-chlorobenzyl)carbamoyl]pyrrolidin-1-yl]-2-oxoethanaminium chloride
3-(3-ethoxy-3-oxopropyl)-6-methoxy-2-methyl-1-benzofuran-5-yl sulfate
3-(4-carbamimidoylphenyl)-2-oxopropanoic acid
3-(benzyl(2-(4-carbamimidoylbenzyl)-4-methyl-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)amino)-3-oxopropanoic acid
112400fold selectivity for thrombin over trypsin, 52450fold selectivitiy for thrombin over factor Xa
3-(benzyl(2-(4-carbamimidoylbenzyl)-4-methyl-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)amino)-4-oxobutanoic acid
1131fold selectivity for thrombin over trypsin, 2427fold selectivitiy for thrombin over factor Xa
3-(ethoxycarbonyl)-2-methyl-1-benzofuran-5,6-diyl disulfate
3-(ethoxycarbonyl)-5-methoxy-2-methyl-1-benzofuran-6-yl sulfate
3-(ethoxycarbonyl)-6-methoxy-2-methyl-1-benzofuran-5-yl sulfate
3-carboxy-2-methyl-1-benzofuran-5,6-diyl disulfate
about 70% inhibition at 2.6 mM
3-carboxy-5-methoxy-2-methyl-1-benzofuran-6-yl sulfate
about 80% inhibition at 2.6 mM
3-carboxy-6-methoxy-2-methyl-1-benzofuran-5-yl sulfate
about 40% inhibition at 2.6 mM
4-methylphenyl 3-[[(2S)-3-(4-carbamimidoylphenyl)-1-(2-methoxypyrrolidin-1-yl)-1-oxopropan-2-yl]amino]-3-oxopropane-1-sulfonate
4-nitrophenyl 2-propyl methylphosphonate
5,6-dihydroxy-2-methyl-1-benzofuran-3-carboxylic acid
about 20% inhibition at 2.6 mM
5-hydroxy-6-methoxy-2-methyl-1-benzofuran-3-carboxylic acid
about 25% inhibition at 2.6 mM
biphasic inhibition
activated protein C
activated protein C has a regulatory function in inhibiting thrombin activation, overview
aeruginosin 298-A
isolated from Microcystis aeruginosa strain NIES-298
aeruginosin 98-B
isolated from Microcystis aeruginosa strain NIES-98
slight inhibition
amino[4-([[1-(3,3-dimethylbutanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(3-cyclohexylpropanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(3-cyclopentylpropanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(3-methylbutanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(3-phenylpropanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(4-methylpentanoyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(cyclohexylacetyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-([[1-(cyclopentylacetyl)-L-prolyl]amino]methyl)phenyl]methaniminium chloride
amino[4-[([[(2S)-1-butanoylpyrrolidin-2-yl]carbonyl]amino)methyl]phenyl]methaniminium chloride
amino[4-[([[(2S)-1-propanoylpyrrolidin-2-yl]carbonyl]amino)methyl]phenyl]methaniminium chloride
conjugation of angiomax to a 5'-amino oligonucleotide and assembly into a two-dimensional DNA lattice for observation of the binding of thrombins to the DNA lattice. Use of the functionalized DNA lattices as a platform for investigation of biomolecular interactions such as drug-protein, protein-protein, DNA-RNA, and DNA-protein interactions in the nano- and subnanoscales
human, enhanced in presence of heparin and dermatan sulfate, hirudin(54-65) peptide protects
antithrombin III
the prodrug AZD-0837 is bioactively converted into the direct thrombin inhibitor ARH-067637
a pentapeptide encompassing amino acid sequence 695–699 from the C-terminus of the heavy chain of factor Va inhibits prothrombin activation by prothrombinase in a competitive manner with respect to substrate, mechanism, overview
L-Asp-L-Phe methyl ester, biphasic inhibition
direct thrombin inhibitor, the prodrug AZD-0837 is bioactively converted into the direct thrombin inhibitor ARH-067637
slight inhibition
tripeptide acyl (alpha-aminoalkyl)phosphonate inhibitor, acts via formation of a metastable pentacoordinated phosphorus intermediate that is non-covalently bound to Ser195, inhibition mechanism
Bovine pancreatic trypsin inhibitor
butyl 4-carbamimidoyl-N-(naphthalen-2-ylsulfonyl)phenylalaninate
CdsO3 binds to exosite II of thrombin to allosterically disrupt the catalytic apparatus resulting in inhibition
i.e. (R)-cyclohexylalanyl-Pro-Arg[CH2OCH2CF3]
chondroitin 6-sulfate
low inhibitory potential in anticoagulation assay
CRC 220
binding mode to the enzyme, crystal structure
potent inhibitor
complete inhibition at 20 mM
dabigatran etexilate
dermatan sulfate
isolated from skin of Raja radula, in presence of heparin cofactor II or antithrombin. Dermatan sulfate from ray skin catalyzes the thrombin inhibition by heparin cofactor II or antithrombin primarily by forming a dermatan sulfate-inhibitor complex more reactive than the free inhibitor towards the protease
diethyl [([[(3-carbamimidoylphenyl)amino](3,4-diphenoxyphenyl)acetyl]amino)methyl]phosphonate
diethyl [([[(4-carbamimidoylphenyl)amino](4-phenoxyphenyl)acetyl]amino)methyl]phosphonate
diethyl [([[2-(benzyloxy)phenyl][(3-carbamimidoylphenyl)amino]acetyl]amino)methyl]phosphonate
slight inhibition
diisopropyl fluorophosphate
dipetalogastin II
strong inhibitor, fron the assassin bug Dipetalogaster maximus
cloning and purification of the chimeric inhibitor composed of the N-terminal head structure of dipetalogastin II and the exosite 1 blcking segment of hirudin, connected through a five glycine linker, MW 7560
DNA aptamer 15-TBA
a thrombin-binding aptamer that binds to thrombin exosites, noncompetitive inhibition type
DNA aptamer 31-TBA
a thrombin-binding aptamer that binds to thrombin exosites, competitive inhibition type
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPRMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMAKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPRMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPRMHKTAPPFDFEAIPEEYphosLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPRMHKTAPPFDFEAIPEEYsulfLDDE, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYphosLDDE, a variegin variant, a fast, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYsulfLDDE, a variegin variant, a fast, tight-binding, competitive inhibitor
small site-directed direct thrombin inhibitor
ellagic acid
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a slow, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a slow, tight-binding, competitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEEIPEEYLDDES, a variegin variant, a fast, tight-binding, competitive inhibitor
slight inhibition
ethyl 2-(benzyl(2-(4-carbamimidoylbenzyl)-4-methyl-3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)amino)-2-oxoacetate
1188fold selectivity for thrombin over trypsin, 537fold selectivitiy for thrombin over factor Xa
ethyl 3-(5-hydroxy-6-methoxy-2-methyl-1-benzofuran-3-yl)propanoate
ethyl 5,6-dihydroxy-2-methyl-1-benzofuran-3-carboxylate
ethyl 5-hydroxy-6-methoxy-2-methyl-1-benzofuran-3-carboxylate
ethyl 6-hydroxy-5-methoxy-2-methyl-1-benzofuran-3-carboxylate
ethyl N-[(2-[[(4-carbamimidoylphenyl)amino]methyl]-1-methyl-1H-benzimidazol-5-yl)carbonyl]-N-pyridin-2-yl-b-alaninate
factor VIII(716-731) peptide
thrombin binding sequence is GDYYEDSYEDISAYLL, competitive
incubation of thrombin with iron sulfate in a final concentration of 0.2 mM for 25-35 min is followed by the loss of thrombin activity, the effect of reversibility depends on the time (0-100 min) of thrombin preincubation with iron. Inactivation of thrombin occurs immediately after addition of Fe2+ ions in high doses
fibrin gamma'-peptides
sulfated and non-sulfated peptide sequences of the gamma'-chains of human fibrin 1 and 2, overview, competitive
fibrinogen 1
down-regulation of thrombin production
fibrinogen 2
more potent inhibition compared to fibrinogen 1, down-regulation of thromin production
fibrinogen gamma'(408-427) peptide
of the gamma'-domain, thrombin binding sequence is VRPEHPAETEYDSLYPEDDL, competitive
formyl-L-Asp-L-Phe methyl ester
biphasic inhibition, 80% inhibition at 2.52 mM, inhibition is reversible
fucosylated chondroitin sulfate
from sea cucumber Ludwigothurea grisea, chemical composition, native or desulfated, carboxyl-reduced, or defucosylated, inhibitory potential in anticoagulation assay, overview, presence of antithrombin or heparin cofactor II is required for inhibition, inhibition of thrombin generation by thromboplastin
slight inhibition
decreases cleavage rates with n-butyl derivatives
glycoprotein Ibalpha(1-282) peptide
binds to exosite II of the enzyme, inhibits activation of factor VIII to more than 70%
glycoprotein Ibalpha(268-282) peptide
binds to exosite II of the enzyme, inhibits activation of factor VIII and cleavage of factor VIII(341-376) peptide to more than 70%
glycosaminoglycan AD17
glycosaminoglycan AD4
shows only small inhibitory activity toward thrombin and the inhibition does not proceed beyond 40% inhibition
glycosaminoglycan AD9
shows only small inhibitory activity toward thrombin and the inhibition does not proceed beyond 40% inhibition
glycosaminoglycan AE11
modest inhibitory effect on thrombin activity
glycosaminoglycan AE15
glycosaminoglycan AE29
glycosaminoglycan AE6
modest inhibitory effect on thrombin activity
glycosaminoglycan CS-D
glycosaminoglycan CS-E
glycosaminoglycan DE17
glycosaminoglycan DE2
glycosaminoglycan DE9
pseudo-complete inhibition, noncompetitive
irreversible thrombin inhibitor
bivalent fusion aptamer consisiting of 15-base spanning DNA aptamer HD1 which specifically inhibits the procoagulant functions of thrombin, and aptamer HD22 which binds to exosite 2 of thrombin, interconnected by a poly-dA linker. Aptamer HD1-22 prolongs clotting times of the thrombin time, activated partial thromboplastin time, ecarin clotting time, and lag-time of the tissue factor triggered thrombin generation assay. thrombin-induced platelet aggregation is more effectively inhibited by HD1-22 than by bivalirudin. The anticoagulant activities of HD1-22 are fully reversed by addition of antidote-oligodeoxynucleotides
aptamer, mitogen
protein of about 20 kDa, isolated from a midgut cDNA library from the hard tick Haemaphysalis longicornis. Hemalin delays bovine plasma clotting time and inhibits both thrombin-induced fibrinogen clotting and platelet aggregation. Hemalin may play a role in tick blood feeding
heparin cofactor II
slight inhibition
slight inhibition
hirudin(53-64) peptide
thrombin binding sequence is NGDFEEIPEEYL, competitive
complete inhibition, noncompetitive
i.e. bivalirudin or DFPRPGGGGNGDFEEIPEEYL, a variegin variant, a fast, tight-binding, competitive inhibitor
human GPIBalpha(269-287) peptide
thrombin binding sequence is DEGDTDLYDYYPEEDTEGD, competitive
human heparin cofactor II(56-75) peptide
thrombin binding sequences are GEEDDDYLDLE and EDDDYIDIVD, competitive
human PAR1(52-69) peptide
thrombin binding sequence is YEPFWEDEEKNESGLTEY, competitive
slight inhibition
inhibitor from Dipetalogaster maximus
a bloodsucking bug, anticoagulant inhibitor, biochemical characterization: slow, tight-binding, N-terminal amino acid sequencing, molecular mass of the four components each about 12 kDa, 9304.7 anti-IU/mg protein
isohamnetin 3-O-nehesperridin
slight inhibition
isorhamnetin 3-O-(6-O-alpha-L-rhamnopyranosyl)-beta-D-glucopyranoside
slight inhibition
kaempferol 3-O-(2',4'-di-(E)-p-coumaroyl)-rhamnoside
kaempferol 3-O-(2'-p-coumaroyl)-rhamnoside
kaempferol 3-O-(2-O-alpha-L-rhamnopyranosyl)-beta-D-glucopyranoside
slight inhibition
kaempferol 3-O-beta-D-glucoside
slight inhibition
methyl (3S)-1-[3-carbamimidoyl-N-(naphthalen-2-ylsulfonyl)phenylalanyl]-2-oxopiperidine-3-carboxylate
methyl (3S)-1-[3-carbamimidoyl-N-(naphthalen-2-ylsulfonyl)phenylalanyl]piperidine-3-carboxylate
methyl 3-carbamimidoyl-N-(naphthalen-2-ylsulfonyl)phenylalanyl-L-prolinate
methyl N-[(4-tert-butylphenyl)sulfonyl]glycyl-3-carbamimidoyl-L-phenylalaninate
methyl N-[[2-(benzyloxy)phenyl][(3-carbamimidoylphenyl)amino]acetyl]-3-(phenyldisulfanyl)alaninate
methyl N-[[4-(hydroxymethyl)-2,3,6-trimethylphenyl]sulfonyl]glycyl-3-carbamimidoyl-L-phenylalaninate
methyl S-benzyl-N-[[(3-carbamimidoylphenyl)amino](2,3-dimethoxyphenyl)acetyl]cysteinate
methyl S-benzyl-N-[[(4-carbamimidoylphenyl)amino](2-fluoro-4,5-dimethoxyphenyl)acetyl]cysteinate
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, noncompetitive inhibitor
i.e. SDQGDVAEPKMAKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, noncompetitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYsulfLDDES, a variegin variant, a fast, tight-binding, noncompetitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, a variegin variant, a fast, tight-binding, noncompetitive inhibitor
i.e. SDQGDVAEPKMHKTAPPFDFEEIPEEYLDDES, a variegin variant, a fast, tight-binding, noncompetitive inhibitor
slight inhibition
13fold selectivity for thrombim over trypsin
23fold selectivity for thrombim over trypsin
42fold selectivity for thrombim over trypsin
16fold selectivity for thrombim over trypsin
i.e. alpha-NAPAP
45% inhibition at 0.01 mM
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-2-cyclohexylacetyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-3,3-dimethylbutanoyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-3-methylbutanoyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-3-phenylpropanoyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-4,4-dimethylpentanoyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammonio-4-methylpentanoyl]-L-prolinamide dichloride
N-[4-[amino(iminio)methyl]benzyl]-1-[(2R)-2-ammoniobutanoyl]-L-prolinamide dichloride
naphthalen-2-yl 3-[[(2S)-3-(4-carbamimidoylphenyl)-1-oxo-1-(piperazin-1-yl)propan-2-yl]amino]-3-oxopropane-1-sulfonate
napsagatran ethyl ester
slight inhibition
slight inhibition
potent endogenous thrombin inhibitor
Phe-Pro-Arg-chloromethyl ketone
propan-2-yl N-(naphthalen-2-ylsulfonyl)glycyl-3-carbamimidoyl-D-phenylalaninate
Protease nexin-1
slight inhibition
quercetin 3-O-rhamnose(1-2)glucose(6-1)rhamnose
slight inhibition
a synthetic, low-molecular cyanopeptide-analogue inhibitor, binding structure and inhibition mechanism, overview
a synthetic, low-molecular cyanopeptide-analogue inhibitor, binding structure and inhibition mechanism, overview
recombinant hirudin containing the RGD motif which competitively inhibits the binding of fibrinogen to GP IIb/IIIa on platelets. Specific anti-thrombin activity of RGD-hirudin is 12000 ATU/mg and equivalent to native hirudin, and it addiotionally inhibits platelet aggregation
slight inhibition
carboxylated derivative of RWJ-51438, benzothiazole-activated inhibitor
benzothiazole-activated inhibitor, binds to His57 of the enzyme via hydrogen bond, the carboxylate substituent on the benzothiazole group forms salt bridges with Lys60F NZ and the NZ of the symmetry-related residues Lys236 and Lys240, which introduces steric effects that perturb the 60A-60I insertion loop, especially at residues Trp60D and Phe60H
sodium 3-(2-carboxyethyl)-6-methoxy-2-methyl-1-benzofuran-5-yl sulfate
about 35% inhibition at 2.6 mM
sodium 3-(5-hydroxy-6-methoxy-2-methyl-1-benzofuran-3-yl)propanoate
about 40% inhibition at 2.6 mM
sulfated fucan
from brown seaweed Ascophylum nodosum, chemical composition, inhibitory potential in anticoagulation assay, inhibition of thrombin generation by thromboplastin
sulfated glycoprotein Ibalpha(268-282) peptide
sulfated at all tyrosine residues, binds to exosite II of the enzyme, inhibits activation of factor VIII and cleavage of factor VIII(341-376) peptide to more than 70%
sulfated polysaccharides from green algae
8 different variants of Codium sp., Caulerpa okamura, Caulerpa brachypus, Monostroma nitidum and Monostrum latissimum, composition overview, inhibition is mediated by heparin cofactor HCII, hirudin(54-65) peptide protects partially, HD22, a ssDNA aptamer, also protects, allosteric inhibition mechanism
i.e. 8, 8'-[carbonylbis[imino-3,1-phenylenecarbonylimino(4-methyl-3,1-phenylene)carbonylimino]]bis-1,3,5-naphthalenetrisulfonic acid, non-competitive inhibitor of human alpha-thrombin activity over fibrinogen
thrombin inhibitor from Naja haje
thrombin-binding aptamer
a consensus DNA 15-mer that binds specifically to human alpha-thrombin at nanomolar concentrations and inhibits its procoagulant functions. A a modified thrombin-binding aptamer, containing a 5'-5' inversion-of-polarity site, is more stable and to possesses a higher thrombin affinity than its unmodified counterpart
complex formation on endothelial cell surfaces blocks thrombin activity
thrombomodulin(408-426) peptide
thrombin binding sequence is GDYYEDSYEDISAYLL, competitive
a low-molecular-weight heparin, an effective inhibitor of thrombin generation and thrombin activity in plasma
Toggle-25 t
partial inhibition, noncompetitive
tosyl-Lys chloromethyl ketone
slight inhibition
i.e. SDQGDVAEPKMHKTAPPFDFEAIPEEYLDDES, isolated from the tropical bont tick, the molecule exhibits a unique two-modes inhibitory property on thrombin active site, i.e. competitive before cleavage, noncompetitive after cleavage, overview. Mechanism of thrombin inhibition by disrupting the charge relay system, a fast, tight-binding, competitive inhibitor
attenuates thrombin-mediated phosphorylation of p38MAPK and p65
[4-[([[(2S)-1-acetylpyrrolidin-2-yl]carbonyl]amino)methyl]phenyl](amino)methaniminium chloride
[6-chloro-3-(2,2-difluoro-2-phenyl-ethylamino)-2-oxo-2H-pyrazin-1-yl]acetic acid
[6-methoxy-2-methyl-5-(sulfonatooxy)-1-benzofuran-3-yl]methyl sulfate
[amino(4-[[([(2S)-1-[(2R)-2-ammoniopropanoyl]pyrrolidin-2-yl]carbonyl)amino]methyl]phenyl)methylidene]ammonium dichloride
additional information
analysis of temperature dependence of pseudo-first order rate constants for enzyme-catalyzed hydrolysis of prothrombin-derived substrates, in presence and absence of Ca2+
high glucose enhances thrombin responses through transcriptional upregulation of protease-activated receptor-4, PAR-4, mediated via PKC-beta, -delta, and NFkappaB, in human vascular smooth muscle cells
factor Xa
gamma' peptide
extensive interactions between thrombin and the gamma' peptide mediated by electrostatic contacts with residues of exosite II and hydrophobic interactions with a pocket in close proximity to the Na+ binding site, complex structure and binding mode, the gamma' peptide completely overlaps with heparin bound to exosite II, overview
increases deacylation rate with p-nitrophenyl-p'-guanidinobenzoate
extensive interactions between thrombin and the gamma' peptide mediated by electrostatic contacts with residues of exosite II and hydrophobic interactions with a pocket in close proximity to the Na+ binding site, complex structure and binding mode, the gamma' peptide completely overlaps with heparin bound to exosite II, overview
lung thromboplastin activator
the activation of bovine prothrombin occurs by bovine lung thromboplastin activator
PolyP, secreted by activated platelets, a highly anionic polymer, polyphosphate plus beta-thrombin accelerates plasma clotting and enhances thrombin generation, kinetics, overview. Thrombin binds with high affinity to immobilized polyphosphate. Polyphosphate accelerates factor XI autoactivation and factor XIa autolysis
protease-activated receptor 3
the cleaved form of protease-activated receptor 3, PAR-3, acts as a cofactor for thrombin cleavage and activation of PAR-4 on murine platelets, interaction analysis of thrombin with the extracellular part of PAR-3, overview
vitamin K
dependent on
additional information
pH 8.0, 25°C
pH 8.0, 25°C
pH 8.0, 25°C
pH 8.0, 25°C
pH 8.0, 25°C
0.0052 - 0.0079
benzoyl-Arg ethyl ester
0.0075 - 0.0088
benzoyl-Arg methyl ester
0.143 - 0.84
0.0015 - 0.0632
0.00033 - 0.013
0.004 - 0.072
0.017 - 0.11
0.0026 - 0.298
0.1471 - 0.2829
factor VIII(341-376) peptide
pH 7.5, 25°C
factor XIII
pH 7.4, 25°C, wild-type enzyme
factor XIII V34L mutant
pH 7.4, 25°C, wild-type enzyme
0.00316 - 0.0528
0.00355 - 0.0113
fibrinogen Aalpha chain
0.0051 - 0.013
Fibrinopeptide A
pH 7.4, 25°C
pH 7.4, 25°C
0.0084 - 0.028
PAR1 peptide
0.0355 - 0.181
platelet thrombin receptor peptide
0.002 - 0.0032
protein C
thrombin-activatable fibrinolysis inhibitor
presence of thrombomodulin, Km(app) value
0.0063 - 0.3
tosyl-Arg methyl ester
0.0085 - 0.0164
pH 7.4, 25°C
pH 7.4, 25°C
additional information
additional information