Any feedback?
Literature summary for 3.4.24.87 extracted from
- Formation of methionine sulfoxide by peroxynitrite at position 1606 of von Willebrand factor inhibits its cleavage by ADAMTS-13: a new prothrombotic mechanism in diseases associated with oxidative stress (2010), Free Radic. Biol. Med., 48, 446-456.
Cloned(Commentary)
| Cloned (Comment) | Organism |
|---|---|
| expression of ADAMTS-13 in HEK293 cells | Homo sapiens |
Inhibitors
| Inhibitors | Comment | Organism | Structure |
|---|---|---|---|
| EDTA | complete inhibition at 10 mM | Homo sapiens |  |
| peroxynitrite | formation of methionine sulfoxide by peroxynitrite at position 1606 of von Willebrand factor inhibits its cleavage by ADAMTS-13 a prothrombotic mechanism in diseases associated with oxidative stress, overview. Oxidation by peroxynitrite of purified VWF multimers inhibits ADAMTS-13 hydrolysis, but does not alter their electrophoretic pattern nor their ability to induce platelet agglutination by ristocetin. In vitro treatment of ADAMTS-13 with peroxynitrite over a concentration ranging from 0.050 to 0.250 mM causes a complete inhibition of the protease activity of the enzyme | Homo sapiens | |
KM Value [mM]
| KM Value [mM] | KM Value Maximum [mM] | Substrate | Comment | Organism | Structure |
|---|---|---|---|---|---|
| additional information | - |
additional information | Michaelis-Menten steady-state kinetics, overview | Homo sapiens | |
| 0.00662 | - |
DREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRA | pH 7.5, 25°C, recombinant enzyme | Homo sapiens | |
Localization
| Localization | Comment | Organism | GeneOntology No. | Textmining |
|---|---|---|---|---|
| extracellular | - |
Homo sapiens | - |
- |
Metals/Ions
| Metals/Ions | Comment | Organism | Structure |
|---|---|---|---|
| Zn2+ | required | Homo sapiens | |
Natural Substrates/ Products (Substrates)
| Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| von Willebrand factor + H2O | Homo sapiens | ADAMTS-13 cleaves von Willebrand factor (VWF) exclusively at the Tyr1605-Met1606 peptide bond in the A2 domain | von Willebrand factor 140-kD fragment + von Willebrand factor 176-kD fragment | - |
? | |
Organism
| Organism | UniProt | Comment | Textmining |
|---|---|---|---|
| Homo sapiens | - |
- |
- |
Purification (Commentary)
| Purification (Comment) | Organism |
|---|---|
| recombinant ADAMTS-13 from HEK293 cells by Zn2+-agarose affinity and anion exchange chromatography to homogeneity | Homo sapiens |
Source Tissue
| Source Tissue | Comment | Organism | Textmining |
|---|---|---|---|
| plasma | - |
Homo sapiens | - |
Substrates and Products (Substrate)
| Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| DREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRA + H2O | i.e. VWF74 peptide, a pseudo-wild-type peptide von Willebrand factor 74, VWF74, encompassing the von Willebrand factor, VWF, A2 domain sequence 1596-1669 | Homo sapiens | ? | - |
? | |
| additional information | construction of substrate peptides VWF Asp1596-Ala1669, i.e. VWF74, VWF Asp1596-Ala1669 containing nitrotyrosine, i.e. VWF74-NT, or methionine sulfoxide, i.e. VWF74-MetSO, at position 1605 or 1606, respectively. VWF74 oxidized by peroxynitrite undergoes a severe impairment of its hydrolysis. Likewise, VWF74-MetSO is minimally hydrolyzed, whereas VWF74-NT is hydrolyzed only slightly more efficiently than VWF74, overview | Homo sapiens | ? | - |
? | |
| von Willebrand factor + H2O | ADAMTS-13 cleaves von Willebrand factor (VWF) exclusively at the Tyr1605-Met1606 peptide bond in the A2 domain | Homo sapiens | von Willebrand factor 140-kD fragment + von Willebrand factor 176-kD fragment | - |
? | |
| von Willebrand factor + H2O | ADAMTS-13 cleaves von Willebrand factor (VWF) exclusively at the Tyr1605-Met1606 peptide bond in the A2 domain | Homo sapiens | von Willebrand factor 140-kD fragment + von Willebrand factor 176-kD fragment | LC-MS product identification | ? | |
Synonyms
| Synonyms | Comment | Organism |
|---|---|---|
| ADAMTS-13 | - |
Homo sapiens |
Temperature Optimum [°C]
| Temperature Optimum [°C] | Temperature Optimum Maximum [°C] | Comment | Organism |
|---|---|---|---|
| 25 | - |
assay at | Homo sapiens |
Turnover Number [1/s]
| Turnover Number Minimum [1/s] | Turnover Number Maximum [1/s] | Substrate | Comment | Organism | Structure |
|---|---|---|---|---|---|
| 0.72 | - |
DREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRA | pH 7.5, 25°C, recombinant enzyme | Homo sapiens | |
pH Optimum
| pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
|---|---|---|---|
| 7.5 | - |
assay at | Homo sapiens |
Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.
Release 2023.1 (January 2023)
Legal
Curated at
Member of
