Literature summary for 3.4.24.69 extracted from

Schmidt, J.J.; Stafford, R.G.
Botulinum neurotoxin serotype F: identification of substrate recognition requirements and development of inhibitors with low nanomolar affinity (2005), Biochemistry, 44, 4067-4073.

Search for more literature for 3.4.24.69

Inhibitors

Inhibitors	Comment	Organism	Structure
AQVDEVVDIMRVNVDKVLERDQ	residues 37-58 of vesicle-associated membrane protein VAMP. Inhibitor exhibits a high degree of specificity for BoNT F, compared to other BoNT serotypes	Clostridium botulinum
GGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	residues 17-58 of vesicle-associated membrane protein VAMP	Clostridium botulinum
LQQTQAQVDEVVDIMRVNVDKVLERDQ	residues 32-58 of vesicle-associated membrane protein VAMP. Inhibitor exhibits a high degree of specificity for BoNT F, compared to other BoNT serotypes	Clostridium botulinum
PPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	residues 22-58 of vesicle-associated membrane protein VAMP. Inhibitor exhibits a high degree of specificity for BoNT F, compared to other BoNT serotypes	Clostridium botulinum
TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	residues 27-58 of vesicle-associated membrane protein VAMP. Inhibitor exhibits a high degree of specificity for BoNT F, compared to other BoNT serotypes	Clostridium botulinum
VVDIMRVNVDKVLERDQ	residues 42-58 of vesicle-associated membrane protein VAMP. Inhibitor exhibits a high degree of specificity for BoNT F, compared to other BoNT serotypes	Clostridium botulinum

Organism

Organism	UniProt	Comment	Textmining
Clostridium botulinum	-	-	-

Substrates and Products (Substrate)

Substrates	Comment Substrates	Organism	Products	Comment (Products)	Rev.	Reac.
vesicle-associated membrane protein VAMP + H2O	BoNT F cleaves VAMP between residues Q58 and K59. The minimum substrate is a peptide containing VAMP residues 32-65, which includes only one of the two VAMP structural motifs thought to be required for botulinum substrate recognition. BoNT F exhibits a strict requirement for residues D57 (P2), K59 (P1'), and L60 (P2'), but peptides containing substitutions for R56 (P3), Q58 (P1), and S61 (P3') are cleaved. Therefore, the P2, P1', and P2'?residues of VAMP are of paramount importance for BoNT F substrate recognition near the scissile bond	Clostridium botulinum	?	-	?

Synonyms

Synonyms	Comment	Organism
BoNT F	-	Clostridium botulinum

Ki Value [mM]

Ki Value [mM]	Ki Value maximum [mM]	Inhibitor	Comment	Organism	Structure
0.000034	-	LQQTQAQVDEVVDIMRVNVDKVLERDQ	-	Clostridium botulinum
0.00028	-	AQVDEVVDIMRVNVDKVLERDQ	-	Clostridium botulinum
0.001	-	PPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	-	Clostridium botulinum
0.0013	-	GGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	-	Clostridium botulinum
0.0019	-	TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ	-	Clostridium botulinum
0.009	-	VVDIMRVNVDKVLERDQ	-	Clostridium botulinum

Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.

Release 2023.1 (January 2023)