Any feedback?
Please rate this page
(literature.php)
(0/150)

BRENDA support

Literature summary for 3.4.23.2 extracted from

  • Foltmann, B.; Szecsi, P.B.
    Pepsin B (2004), Handbook of Proteolytic Enzymes (Barrett, J. ; Rawlings, N. D. ; Woessner, J. F. , eds. ), 1, 28-29.
No PubMed abstract available
Search for more literature for 3.4.23.2

Molecular Weight [Da]

Molecular Weight [Da] Molecular Weight Maximum [Da] Comment Organism
36000
-
 x * 41000, pepsinogen, SDS-PAGE, x * 36000, pepsin B, SDS-PAGE Sus scrofa
41000
-
 x * 41000, pepsinogen, SDS-PAGE, x * 36000, pepsin B, SDS-PAGE Sus scrofa

Natural Substrates/ Products (Substrates)

Natural Substrates Organism Comment (Nat. Sub.) Natural Products Comment (Nat. Pro.) Rev. Reac.
Gelatin + H2O Sus scrofa liquefication ?
-
 ?
additional information Sus scrofa the enzyme shows milk clotting activity ?
-
 ?

Organism

Organism UniProt Comment Textmining
Sus scrofa
-
-
-

Posttranslational Modification

Posttranslational Modification Comment Organism
proteolytic modification pepssinogen B is proteolytically activated in the gastric tract, first cleavage site is Met16-Glu17, convertion at pH 5.5, not at pH 2.0 Sus scrofa

Purification (Commentary)

Purification (Comment) Organism
native pepsinogen by gel filtration and anion exchange chromatography to homogeneity Sus scrofa

Source Tissue

Source Tissue Comment Organism Textmining
gastric mucosa production of pepsinogen Sus scrofa
-

Substrates and Products (Substrate)

Substrates Comment Substrates Organism Products Comment (Products) Rev. Reac.
Ac-Phe-Tyr radio-labeled substrate Sus scrofa Ac-Phe + Tyr
-
 ?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O oxidized insulin B chain, cleavage site specificity determination Sus scrofa FVNQHLCGSHL + VEA + Leu + Tyr + LVCGERGF + Phe + YTPKA
-
 ?
Gelatin + H2O liquefication Sus scrofa ?
-
 ?
Hemoglobin + H2O acid-denatured protein substrate Sus scrofa ?
-
 ?
additional information the enzyme shows milk clotting activity Sus scrofa ?
-
 ?
additional information the enzyme shows generally low proteolytic activity Sus scrofa ?
-
 ?

Subunits

Subunits Comment Organism
? x * 41000, pepsinogen, SDS-PAGE, x * 36000, pepsin B, SDS-PAGE Sus scrofa

Synonyms

Synonyms Comment Organism
More the enzyme belongs to the A1 peptidase family Sus scrofa

pH Optimum

pH Optimum Minimum pH Optimum Maximum Comment Organism
3
-
-
 Sus scrofa

pH Stability

pH Stability pH Stability Maximum Comment Organism
4 6.9 room temperature, pepsin is stable Sus scrofa