Inhibitors | Comment | Organism | Structure |
---|---|---|---|
Diazoacetyl-DL-norleucine methyl ester | i.e. DAN | Nepenthes distillatoria | |
N-(diazoacetyl)-N-(2,4-dinitrophenyl)ethylenediamine | - |
Nepenthes distillatoria | |
pepstatin | - |
Nepenthes distillatoria |
Localization | Comment | Organism | GeneOntology No. | Textmining |
---|---|---|---|---|
extracellular | the enzyme is secreted to the pitcher fluid | Nepenthes distillatoria | - |
- |
Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
---|---|---|---|
45000 | - |
1 * 45000 | Nepenthes distillatoria |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Nepenthes distillatoria | - |
- |
- |
Purification (Comment) | Organism |
---|---|
by gel filtration, ion exchange chromatography, and pepstatin affinity chromatography, native enzyme to homogeneity | Nepenthes distillatoria |
Source Tissue | Comment | Organism | Textmining |
---|---|---|---|
pitcher | secretory gland inside the pitcher | Nepenthes distillatoria | - |
pitcher secretion | - |
Nepenthes distillatoria | - |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
casein + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
Egg albumin + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
Fibrin + H2O | - |
Nepenthes distillatoria | ? | - |
? | |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | substrate is the insulin B chain | Nepenthes distillatoria | FVNQHL + CGSHLVE + Ala-Leu + Tyr + LVCGERGF + FYTPKA | - |
? | |
additional information | cleavage site specificity with preference for the carboxy and amino sides of Asp, cleavage of the carboxy side of Ala, Leu, Ser, Thr, and Tyr also occurs, and cleavage on the amino side of Ala, Phe, Thr, Tyr, and Lys | Nepenthes distillatoria | ? | - |
? | |
Ribonuclease + H2O | - |
Nepenthes distillatoria | ? | - |
? |
Subunits | Comment | Organism |
---|---|---|
monomer | 1 * 45000 | Nepenthes distillatoria |
Synonyms | Comment | Organism |
---|---|---|
More | the enzyme belongs to the A1 peptidase family | Nepenthes distillatoria |
pH Optimum Minimum | pH Optimum Maximum | Comment | Organism |
---|---|---|---|
2 | 3 | - |
Nepenthes distillatoria |