Any feedback?
Please rate this page
(literature.php)
(0/150)

BRENDA support

Literature summary for 1.14.11.30 extracted from

  • Koivunen, P.; Hirsilae, M.; Guenzler, V.; Kivirikko, K.I.; Myllyharju, J.
    Catalytic properties of the asparaginyl hydroxylase (FIH) in the oxygen sensing pathway are distinct from those of its prolyl 4-hydroxylases (2004), J. Biol. Chem., 279, 9899-9904.
    View publication on PubMed

Activating Compound

Activating Compound Comment Organism Structure
ascorbate required, Km: 0.26 mM Homo sapiens

Cloned(Commentary)

Cloned (Comment) Organism
HIF asparaginyl hydroxylase (FIH), His-FIH, FIH-FLAGHis, FIH-V5His, and GST-FIH polypeptides are expressed in Spodoptera frugiperda Sf9 cells Homo sapiens

Inhibitors

Inhibitors Comment Organism Structure
3,4-dihydroxybenzoate
-
Homo sapiens
additional information the Ki-value for 3-hydroxypyridine-2-carbonylglycine and N-((3-hydroxy-6-chloroquinolin-2-yl)carbonyl)glycine are above 0.3 mM Homo sapiens
oxalylglycine
-
Homo sapiens
Pyridine-2,4-dicarboxylate
-
Homo sapiens
Pyridine-2,5-dicarboxylate
-
Homo sapiens

KM Value [mM]

KM Value [mM] KM Value Maximum [mM] Substrate Comment Organism Structure
0.025
-
2-oxoglutarate pH 7.8, 37°C, Km-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.09
-
O2 pH 7.8, 37°C. The Km of FIH for O2 is about 40% of its atmospheric concentration, Km-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens

Metals/Ions

Metals/Ions Comment Organism Structure
Fe2+ required, Km: 0.0005 mM Homo sapiens

Natural Substrates/ Products (Substrates)

Natural Substrates Organism Comment (Nat. Sub.) Natural Products Comment (Nat. Pro.) Rev. Reac.
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 Homo sapiens the activity of hypoxia-inducible transcription factor HIF, an alphabeta heterodimer that has an essential role in adaptation to low oxygen availability, is regulated by two oxygen-dependent hydroxylation events. Hydroxylation of specific proline residues by HIF prolyl 4-hydroxylases targets the HIF-alpha subunit for proteasomal destruction, whereas hydroxylation of an asparagine in the C-terminal transactivation domain prevents its interaction with the transcriptional coactivator p300 hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2
-
?

Organism

Organism UniProt Comment Textmining
Homo sapiens
-
-
-

Purification (Commentary)

Purification (Comment) Organism
-
Homo sapiens

Substrates and Products (Substrate)

Substrates Comment Substrates Organism Products Comment (Products) Rev. Reac.
DESGLPQLTSYDCEVNAPI + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 788-806. 9% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
DESGLPQLTSYDCEVNAPIQGSR + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 788-810. 15% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQ + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 788-814. 37% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQGEEL + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 788-818. 26% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 788-822 Homo sapiens ?
-
?
ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL + 2-oxoglutarate + O2 hypoxia-inducible factor-2alpha peptide 832-857. 7% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 the activity of hypoxia-inducible transcription factor HIF, an alphabeta heterodimer that has an essential role in adaptation to low oxygen availability, is regulated by two oxygen-dependent hydroxylation events. Hydroxylation of specific proline residues by HIF prolyl 4-hydroxylases targets the HIF-alpha subunit for proteasomal destruction, whereas hydroxylation of an asparagine in the C-terminal transactivation domain prevents its interaction with the transcriptional coactivator p300 Homo sapiens hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2
-
?
hypoxia-inducible factor-L-asparagine + 2-oxoglutarate + O2 the enzyme requires particularly long peptide substrates, so that omission of only a few residues from the N or C terminus of a 35-residue HIF-1alpha sequence markedly reduces its substrate activity. Hydroxylation of two HIF-2alpha peptides is far less efficient than that of the corresponding HIF-1alpha peptides Homo sapiens hypoxia-inducible factor-(3S)-3-hydroxy-L-asparagine + succinate + CO2
-
?
LTRYDCEVNVPVLGSSTLL + O2 hypoxia-inducible factor-2alpha peptide 839-866. 1% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
LTSYDCEVNAPIQGSRNLL + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 795-813. 4% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN + 2-oxoglutarate + O2 hypoxia-inducible factor-1alpha peptide 775-826. 120% of the activity obtained with the 35-amino-acid HIF-1alpha peptide DES35 (DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL) Homo sapiens ?
-
?

Subunits

Subunits Comment Organism
dimer
-
Homo sapiens

Synonyms

Synonyms Comment Organism
FIH
-
Homo sapiens
HIF asparaginyl hydroxylase
-
Homo sapiens

Temperature Optimum [°C]

Temperature Optimum [°C] Temperature Optimum Maximum [°C] Comment Organism
37
-
assay at Homo sapiens

Turnover Number [1/s]

Turnover Number Minimum [1/s] Turnover Number Maximum [1/s] Substrate Comment Organism Structure
additional information
-
additional information the catalytic center activities obtained for the enzyme purified by two alternative procedures are 85-135 and 70-120 mol/mol/min, respectively Homo sapiens

pH Optimum

pH Optimum Minimum pH Optimum Maximum Comment Organism
7.8
-
assay at Homo sapiens

Ki Value [mM]

Ki Value [mM] Ki Value maximum [mM] Inhibitor Comment Organism Structure
additional information
-
additional information the Ki-value for 3-hydroxypyridine-2-carbonylglycine and N-((3-Hydroxy-6-chloroquinolin-2-yl)carbonyl)glycine are above 0.3 mM Homo sapiens
0.002
-
oxalylglycine pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.01
-
3,4-dihydroxybenzoate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.03
-
Pyridine-2,4-dicarboxylate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.05
-
Pyridine-2,5-dicarboxylate pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.1
-
PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.1
-
DESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRAL pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens
0.16
-
ESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRAL pH 7.8, 37°C, Ki-value is determined using soluble extracts of cells expressing enzyme-FLAGHis Homo sapiens