Information on EC 3.4.23.42 - thermopsin

Word Map on EC 3.4.23.42
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)


The expected taxonomic range for this enzyme is: Sulfolobus

EC NUMBER
COMMENTARY hide
3.4.23.42
-
RECOMMENDED NAME
GeneOntology No.
thermopsin
-
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
similar in specificity to pepsin A preferring bulky hydrophobic amino acids in P1 and P1'
show the reaction diagram
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
-
-
-
-
CAS REGISTRY NUMBER
COMMENTARY hide
126125-05-1
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
bovine insulin B-chain + H2O
-
show the reaction diagram
Bovine serum albumin + H2O
?
show the reaction diagram
-
-
-
-
?
carbonic anhydrase + H2O
?
show the reaction diagram
-
-
-
-
?
chicken egg albumin + H2O
?
show the reaction diagram
-
-
-
-
?
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHL + VEAL + YLVCGERGF + L-Phe + YTPKA
show the reaction diagram
-
substrate insulin B chain
-
-
?
glyceraldehyde-3-phosphate dehydrogenase + H2O
?
show the reaction diagram
-
-
-
-
?
Hemoglobin + H2O
?
show the reaction diagram
insulin B chain + H2O
?
show the reaction diagram
Lys-Pro-Ala-Glu-Phe-(4-nitro)Phe-Ala-Leu + H2O
Lys-Pro-Ala-Glu-Phe + (4-nitro)Phe-Ala-Leu
show the reaction diagram
Lys-Pro-Ala-Glu-Phe-Nph-Ala-Leu + H2O
Lys-Pro-Ala-Glu-Phe + Nph-Ala-Leu
show the reaction diagram
-
synthetic chromogenic substrate
-
-
?
N-CBZ-glycine 4-nitrophenyl ester + H2O
N-CBZ-Gly + 4-nitrophenol
show the reaction diagram
ovalbumin + H2O
?
show the reaction diagram
-
-
-
-
?
oxidized insulin B + H2O
?
show the reaction diagram
-
following bonds are hydrolyzed: Leu-Val, Leu-Tyr, Phe-Phe, Phe-Tyr, Tyr-Thr
-
-
?
Protein + H2O
?
show the reaction diagram
-
in growth medium
-
-
-
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
Hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
Protein + H2O
?
show the reaction diagram
-
in growth medium
-
-
-
additional information
?
-
-
the enzyme shows a broad protein substrate specificity, it is involved in supply of nutrients from protein substrates
-
-
-
INHIBITORS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
1,2-epoxy-3-(4-nitrophenoxy)propane
-
inactivation
1,2-epoxy-3-(p-nitrophenoxy)propane
-
-
diazoacetyl-DL-norleucine
-
-
Diazoacetyl-DL-norleucine methyl ester
HgCl2
-
reversible by 2-mercaptoethanol
Mercuric acetate
-
-
Pepstatin
pepstatin A
-
competitive inhibition
phenylalaninamide
-
-
additional information
-
KM VALUE [mM]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.053
Lys-Pro-Ala-Glu-Phe-(4-nitro)Phe-Ala-Leu
-
-
Ki VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
400
acetamide
-
-
0.00012 - 0.00049
pepstatin A
10
phenylalaninamide
-
-
SPECIFIC ACTIVITY [µmol/min/mg]
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
additional information
-
-
pH RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
0 - 12
-
activity range, highest activity at pH 1.0- pH 5.0, substrate hemoglobin
1.3 - 3.7
pH 1.3: about 60% of maximal activity, pH 3.7: about 55% of maximal activity
2 - 4
pH 2.0: optimum, pH 4.0: about 50% of maximal activity, no activity detectable at pH 6.0
TEMPERATURE RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
0 - 100
-
activity range, substrate hemoglobin, slow activity increase between 26°C and 65°C, rapid increase above 65°C
60 - 100
60°C: about 30% of maximal activity, 100°C: about 70% of maximal activity
70 - 90
70°C: optimum, 90°C: 80% of maximal activity
SOURCE TISSUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
SOURCE
additional information
-
optimal cell cultivation at pH 2.0 and 70°C
Manually annotated by BRENDA team
LOCALIZATION
ORGANISM
UNIPROT
COMMENTARY hide
GeneOntology No.
LITERATURE
SOURCE
-
attached to the cell suface
-
Manually annotated by BRENDA team
MOLECULAR WEIGHT
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
46000
gel filtration; gel filtration
51000
1 * 51000, SDS-PAGE; 1 * 51000, SDS-PAGE
SUBUNITS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
?
-
x * 32651, amino acid sequence calculation, x * 46000-51000, glycosylated enzyme
monomer
POSTTRANSLATIONAL MODIFICATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
glycoprotein
side-chain modification
-
glycoprotein
TEMPERATURE STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
50 - 90
stable within
GENERAL STABILITY
ORGANISM
UNIPROT
LITERATURE
80°C, 48 hours, pH 4.5
STORAGE STABILITY
ORGANISM
UNIPROT
LITERATURE
4°C, several months
-
Purification/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
native enzyme from cell culture by solubilization with detergents, ultrafiltration and five chromatographic steps to homogeneity
-
Cloned/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
expression in Baculovirus/Sf9 cells; expression in Escherichia coli
-
expression in Escherichia coli
-
expression in Escherichia coli inclusion bodies, expression in insect cells
-
EXPRESSION
ORGANISM
UNIPROT
LITERATURE
overproduced in response to the peptide-enriched media
Renatured/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
recombinant enzyme from Escherichia coli inclusion bodies by treatment with 8 M urea, incubation in acid solution, and gel filtration
-