Information on EC 3.4.21.26 - prolyl oligopeptidase

New: Word Map on EC 3.4.21.26
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Mark a special word or phrase in this record:
Search Reference ID:
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)


The expected taxonomic range for this enzyme is: Bacteria, Eukaryota, Archaea

EC NUMBER
COMMENTARY hide
3.4.21.26
-
RECOMMENDED NAME
GeneOntology No.
prolyl oligopeptidase
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
Hydrolysis of --Pro-/- and to a lesser extent --Ala-/- in oligopeptides
show the reaction diagram
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis
hydrolysis of peptide bond
-
-
endopeptidase
-
CAS REGISTRY NUMBER
COMMENTARY hide
72162-84-6
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
ATC29413
-
-
Manually annotated by BRENDA team
ATC29413
-
-
Manually annotated by BRENDA team
Columbia ecotype
-
-
Manually annotated by BRENDA team
Ascidia sp.
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
estimated as a fraction of papaya latex
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
UniProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
sunn pest
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
CNRZ32
SwissProt
Manually annotated by BRENDA team
Barbara ecotype
-
-
Manually annotated by BRENDA team
Lyophyllum cinerascens
-
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
KU-22
-
-
Manually annotated by BRENDA team
KU-22
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
flesh fly
-
-
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
strain NA1, isolated from the deep-sea hydrohermal vent area of the PACMANUS field in the East Manus Basin
SwissProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
GENERAL INFORMATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
malfunction
metabolism
physiological function
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
(S)-benzyl 2-(2-(4-hydroxynaphthalen-1-ylcarbamoyl)pyrrolidin-1-yl)-2-oxoethylcarbamate + H2O
?
show the reaction diagram
18 kD protein of photosystem II + H2O
?
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Arg-Pro-Pro-Gly-Phe-Ser-Pro + Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
the fluorescence resonance energy transfer peptide sequence corresponds to bradykinin from human kininogen
-
-
?
2-aminobenzoyl-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-Ser-Ser-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Arg-Pro-Pro-Gly-Phe-Ser-Pro + Phe-Arg-Ser-Ser-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
the fluorescence resonance energy transfer peptide sequence corresponds to bradykinin from human kininogen
-
-
?
2-aminobenzoyl-EGPQGLLGA-3-nitrotyrosyl-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-FFQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-FPQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
2-aminobenzoyl-FP + Q-(N-(2,4-dinitrophenyl)ethylenediamine)
show the reaction diagram
-
-
-
?
2-aminobenzoyl-FSQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Glu-Gly-L-Phe-Gly-L-Pro-L-Phe-Gly-L-4-nitrophenylalanine-L-Ala + H2O
2-aminobenzoyl-Glu-Gly-L-Phe-Gly-L-Pro + L-Phe-Gly-L-4-nitrophenylalanine-L-Ala
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-Glu-Gly-Phe-Ser-Pro-Phe(NO2)-Arg-Ala + H2O
2-aminobenzoyl-Glu-Gly-Phe-Ser-Pro + Phe(NO2)-Arg-Ala
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Glu-Phe-Ser-Pro-Phe(NO2)-Arg-Ala + H2O
2-aminobenzoyl-Glu-Phe-Ser-Pro + Phe(NO2)-Arg-Ala
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Gly-Glu-Ser-Pro-Phe(NO2)-Arg-Ala + H2O
2-aminobenzoyl-Gly-Glu-Ser-Pro + Phe(NO2)-Arg-Ala
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Gly-L-Phe-Gly-L-Pro-L-Phe-Gly-L-4-nitrophenylalanine-L-Ala + H2O
2-aminobenzoyl-Gly-L-Phe-Gly-L-Pro + L-Phe-Gly-L-4-nitrophenylalanine-L-Ala
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-Gly-L-Phe-L-Arg-L-Pro-L-4-nitrophenylalanine-L-Arg-L-Ala + H2O
2-aminobenzoyl-Gly-L-Phe-L-Arg-L-Pro + L-4-nitrophenylalanine-L-Arg-L-Ala
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-Gly-Phe-Arg-Pro-Phe(NO2)-Arg-Ala + H2O
2-aminobenzoyl-Gly-Phe-Arg-Pro + Phe(NO2)-Arg-Ala
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Gly-Phe-Glu-Pro-Phe(NO2)-Arg-Ala + H2O
2-aminobenzoyl-Gly-Phe-Glu-Pro + Phe(NO2)-Arg-Ala
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Gly-Phe-Gly-Pro-Phe-Gly-Phe(NO2)-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-Gly-Phe-Gly-Pro-Phe-Gly-Phe(NO2)-Ala-NH2 + H2O
2-aminobenzoyl-Gly-Phe-Gly-Pro + Phe-Gly-Phe(NO2)-Ala-NH2
show the reaction diagram
2-aminobenzoyl-Gly-Phe-Ser-Pro-Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Phe-Ser-Pro + Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
a fluorescence resonance energy transfer peptide
-
-
?
2-aminobenzoyl-Gly-Phe-Ser-Pro-Phe-Arg-Ser-Ser-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Phe-Ser-Pro + Phe-Arg-Ser-Ser-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
the fluorescence resonance energy transfer peptide sequence corresponds to bradykinin from human kininogen
-
-
?
2-aminobenzoyl-Gly-Phe-Ser-Pro-Phe-Arg-Ser-Ser-Arg-Ile-Gly-GLu-Ile-Lys-Glu-Glu-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Phe-Ser-Pro + Phe-Arg-Ser-Ser-Arg-Ile-Gly-GLu-Ile-Lys-Glu-Glu-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
the fluorescence resonance energy transfer peptide sequence corresponds to bradykinin from human kininogen
-
-
?
2-aminobenzoyl-Gly-Pro-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Pro + Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
2-aminobenzoyl-Gly-Pro-Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Pro + Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
a fluorescence resonance energy transfer peptide
-
-
?
2-aminobenzoyl-Gly-Pro-Phe-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Pro + Phe-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
a fluorescence resonance energy transfer peptide
-
-
?
2-aminobenzoyl-Gly-Ser-Pro-Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine + H2O
2-aminobenzoyl-Gly-Ser-Pro + Phe-Arg-Gln-N-(2,4-dinitrophenyl)ethylenediamine
show the reaction diagram
-
a fluorescence resonance energy transfer peptide
-
-
?
2-aminobenzoyl-L-Ser-L-Pro-L-4-nitrophenylalanine-L-Ala + H2O
2-aminobenzoyl-L-Ser-L-Pro + 4-nitrophenylalanine-L-Ala
show the reaction diagram
-
-
-
-
?
2-aminobenzoyl-RPPGFQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-RPPGFSPFRQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
2-aminobenzoyl-RPP + GFSPFRQ-(N-(2,4-dinitrophenyl)ethylenediamine)
show the reaction diagram
-
-
-
?
2-aminobenzoyl-SPFRQ-(N-(2,4-dinitrophenyl)ethylenediamine) + H2O
?
show the reaction diagram
-
-
-
?
4-((4-(dimethylamino)phenyl)azo)benzoyl-GPQGLLGA-L-glutamyl-gamma-(2-(1-sulfonyl-5-naphthyl)-aminoethylamide)-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
Abz-Gly-L-Phe-L-Arg-L-Pro-L-Phe(NO2)-L-Arg-L-Ala + H2O
Abz-Gly-L-Phe-L-Arg-L-Pro + L-Phe(NO2)-L-Arg-L-Ala
show the reaction diagram
-
-
-
-
?
Abz-Gly-L-Phe-L-Ser-L-Pro-L-Phe-L-Arg-L-Ser-L-Ser-L-Arg-L-Ile-Gly-L-Glu-L-Ile-L-Lys-L-Glu-L-Glu-L-Gln-N-(2,4-dinitrophenyl)-ethylenediamine + H2O
Abz-Gly-L-Phe-L-Ser-L-Pro + L-Phe-L-Arg-L-Ser-L-Ser-L-Arg-L-Ile-Gly-L-Glu-L-Ile-L-Lys-L-Glu-L-Glu-L-Gln-N-(2,4-dinitrophenyl)-ethylenediamine
show the reaction diagram
-
-
-
-
?
AbzGFGPFGF(p-NO2)A-NH2 + H2O
AbzGFGP + FGF(p-NO2)A-NH2
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
Ac-CDPGYIGSR-NH2 + H2O
?
show the reaction diagram
-
substrate specificity studies on membrane PE as compared with POP. ZPP-sensitive cleavage of both occurred
-
-
?
Ala-Ala-Pro-4-nitroanilide + H2O
Ala-Ala-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Ala-Gly-Pro-beta-naphthylamide + H2O
Ala-Gly-Pro + beta-naphthylamide
show the reaction diagram
Lyophyllum cinerascens
-
-
-
?
Ala-Pro-4-nitroanilide + H2O
Ala-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Ala-Pro-p-nitroanilide + H2O
Ala-Pro + p-nitroaniline
show the reaction diagram
-
-
-
?
alpa2-antiplasmin + H2O
?
show the reaction diagram
-
not a robust substrate in vitro, the enzyme cleaves after Pro12 in the T9S10G11P12-N13 Q14E15Q16E17 sequence
-
-
?
alpha-melanocyte-stimulating hormone + H2O
?
show the reaction diagram
alpha-MSH(1-13) + H2O
alpha-MSH(1-12) + Pro
show the reaction diagram
-
increased ratio between substrate and product in pituitaries of prolyl endopeptidase deficient mice compared to wild type mice
-
-
?
alpha-synuclein + H2O
?
show the reaction diagram
-
-
-
-
?
alpha-synulein + H2O
?
show the reaction diagram
-
the enzyme binds to alpha-synuclein and enhances its dimerization
-
-
?
alpha2-gliadin 33-mer + H2O
?
show the reaction diagram
-
the enzyme is able to break down 63% of the 33-mer after 8 h of incubation and it is almost completely degraded after 12 h
-
-
?
Angiotensin I + H2O
?
show the reaction diagram
Angiotensin II + H2O
?
show the reaction diagram
Arg-Pro-4-nitroanilide + H2O
Arg-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Arg-Pro-Lys-His-Pro-Ile-Lys-His-Gln + H2O
Arg-Pro-Lys-His-Pro + Ile-Lys-His-Gln
show the reaction diagram
Arg-Pro-p-nitroanilide + H2O
Arg-Pro + p-nitroaniline
show the reaction diagram
-
-
-
?
arginine-vasopressin + H2O
?
show the reaction diagram
Asp-Pro-4-nitroanilide + H2O
Asp-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Asp-Pro-p-nitroanilide + H2O
Asp-Pro + p-nitroaniline
show the reaction diagram
-
-
-
?
azocasein + H2O
?
show the reaction diagram
benzoyloxycarbonyl-Gly-L-Pro-Nap + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Ala-4-nitroanilide + H2O
benzyloxycarbonyl-Ala-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Ala-beta-naphthylamide + H2O
benzyloxycarbonyl-Ala-Ala + beta-naphthylamine
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Ala-Ala-p-nitroanilide + H2O
benzyloxycarbonyl-Ala-Ala + p-nitroaniline
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Ala-Ala-p-nitrophenol + H2O
benzyloxycarbonyl-Ala-Ala + p-nitrophenol
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Ala-Gly-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-Ala-Gly-Pro + beta-naphthylamine
show the reaction diagram
benzyloxycarbonyl-Ala-Gly-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-Ala-Gly-Pro + p-nitrophenol
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-Ala-Pro-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Pro-4-nitroanilide + H2O
benzyloxycarbonyl-Ala-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-Ala-Pro + beta-naphthylamine
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Ala-Pro-p-nitroanilide + H2O
benzyloxycarbonyl-Ala-Pro + p-nitroaniline
show the reaction diagram
benzyloxycarbonyl-Ala-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-Ala-Pro + p-nitrophenol
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-D-Ala-Gly-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-D-Ala-Gly-Pro + beta-naphthylamine
show the reaction diagram
benzyloxycarbonyl-D-Ala-Gly-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-D-Ala-Gly-Pro + p-nitrophenol
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-D-Ala-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-D-Ala-Pro + beta-naphthylamine
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Gly-Gly-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-Gly-Gly-Pro + p-nitrophenol
show the reaction diagram
benzyloxycarbonyl-Gly-L-Pro-4-nitroanilide + H2O
?
show the reaction diagram
benzyloxycarbonyl-Gly-L-Pro-4-nitroanilide + H2O
benzyloxycarbonyl-Gly-L-Pro + 4-nitroaniline
show the reaction diagram
benzyloxycarbonyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
benzyloxycarbonyl-Gly-L-Pro-beta-naphthylamide + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Gly-L-Pro-doxorubicin + H2O
benzyloxycarbonyl-Gly-L-Pro + doxorubicin
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Gly-L-Pro-melphalan + H2O
benzyloxycarbonyl-Gly-L-Pro + melphalan
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Gly-Pro-2-beta-naphthylamide + H2O
?
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-2-naphthylamide + H2O
benzyloxycarbonyl-Gly-Pro + 2-naphthylamine
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-4-methylcoumarin 7-amide + H2O
?
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-4-methylcoumaryl-7-amide + H2O
benzyloxycarbonyl-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-4-nitroanilide + H2O
benzyloxycarbonyl-Gly-Pro + 4-nitroaniline
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-4-nitrophenyl ester + H2O
benzyloxycarbonyl-Gly-Pro + 4-nitrophenol
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Gly-Pro-Ala + H2O
benzyloxycarbonyl-Gly-Pro + Ala
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-Gly-Pro + beta-naphthylamide
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-beta-naphthylamide + H2O
benzyloxycarbonyl-Gly-Pro + beta-naphthylamine
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-D-Ala + H2O
benzyloxycarbonyl-Gly-Pro + D-Ala
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-Gly-Pro-D-Leu + H2O
benzyloxycarbonyl-Gly-Pro + D-Leu
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-Gly-Pro-Leu + H2O
benzyloxycarbonyl-Gly-Pro + Leu
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Leu-Ala + H2O
benzyloxycarbonyl-Gly-Pro + Leu-Ala
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Leu-D-Ala + H2O
benzyloxycarbonyl-Gly-Pro + Leu-D-Ala
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Leu-Gly + H2O
benzyloxycarbonyl-Gly-Pro + Leu-Gly
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Leu-Gly-Ala + H2O
benzyloxycarbonyl-Gly-Pro + Leu-Gly-Ala
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Leu-Gly-D-Ala + H2O
benzyloxycarbonyl-Gly-Pro + Leu-Gly-D-Ala
show the reaction diagram
-
enzyme from kidney
-
?
benzyloxycarbonyl-Gly-Pro-Leu-Gly-Gly + H2O
benzyloxycarbonyl-Gly-Pro + Leu-Gly-Gly
show the reaction diagram
Benzyloxycarbonyl-Gly-Pro-Leu-Gly-Pro + H2O
Benzyloxycarbonyl-Gly-Pro + Leu-Gly-Pro
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-p-nitroanilide + H2O
benzyloxycarbonyl-Gly-Pro + p-nitroaniline
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-Gly-Pro + p-nitrophenol
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-Phe + H2O
benzyloxycarbonyl-Gly-Pro + Phe
show the reaction diagram
benzyloxycarbonyl-Gly-Pro-SBzl + H2O
benzyloxycarbonyl-Gly-Pro + phenyl-methanethiol
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Gly-Pro-thiobenzyl ester + H2O
benzyloxycarbonyl-Gly-Pro + phenylmethanethiol
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-glycyl-l-prolyl-4-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-glycyl-proline-p-nitroanilide + H2O
?
show the reaction diagram
benzyloxycarbonyl-L-Ala-L-Ala-L-Pro p-nitroanilide + H2O
?
show the reaction diagram
benzyloxycarbonyl-Pro-p-nitrophenol + H2O
benzyloxycarbonyl-Pro + p-nitrophenol
show the reaction diagram
-
enzyme from kidney
-
?
beta-amyloid + H2O
?
show the reaction diagram
-
-
-
-
?
beta-endorphin + H2O
?
show the reaction diagram
Bradykinin + H2O
?
show the reaction diagram
bradykinin potentiating peptide + H2O
?
show the reaction diagram
calcitonin gene-related peptide + H2O
?
show the reaction diagram
-
assay at pH 7.0, 37C
-
-
?
casein + H2O
?
show the reaction diagram
-
-
-
-
?
Collagen + H2O
?
show the reaction diagram
collagen + H2O
N-acetyl-Pro-Gly-Pro + ?
show the reaction diagram
-
after enzyme activation with LPS
-
-
?
collagen + H2O
Pro-Gly-Pro + ?
show the reaction diagram
-
after enzyme activation with LPS
-
-
?
collagen I + H2O
?
show the reaction diagram
assay at pH 8.0, 37C
-
-
?
collagens + H2O
?
show the reaction diagram
DRVYIHPF + H2O
DRVYIHP + L-Phe
show the reaction diagram
-
-
-
?
EYYDPNYLRT + H2O
EYDP + NYLRT
show the reaction diagram
-
-
-
?
Fibronectin + H2O
?
show the reaction diagram
furylacryloyl-Ala-Pro + H2O
?
show the reaction diagram
-
-
-
-
?
FVNEHLCGSHLVQALTLVCGQRGFFYTPLA + H2O
FVNEHLCGSHLVQALTLVCGQRGFFYTP + LA
show the reaction diagram
-
-
-
?
GEPGPPGPA + H2O
GEP + GPPGP + L-Ala
show the reaction diagram
-
-
-
-
?
GFSPFRQED + H2O
GFSP + FRQED
show the reaction diagram
-
-
-
-
?
gliadins + H2O
?
show the reaction diagram
gluten + H2O
?
show the reaction diagram
gluten peptide + H2O
?
show the reaction diagram
gluten peptides + H2O
?
show the reaction diagram
Gly-L-Pro-4-nitroanilide + H2O
Gly-L-Pro + 4-nitroaniline
show the reaction diagram
Gly-L-Pro-7-amido-4-methylcoumarin + H2O
Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
Gly-Pro-4-methoxy-beta-naphthylamide + H2O
Gly-Pro + 4-methoxy-beta-naphthylamine
show the reaction diagram
-
-
-
-
?
Gly-Pro-4-nitroanilide + H2O
Gly-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Gly-Pro-p-nitroanilide + H2O
Gly-Pro + p-nitroaniline
show the reaction diagram
-
-
-
?
GnRH + H2O
?
show the reaction diagram
-
-
-
?
gonadotropin releasing hormone + H2O
?
show the reaction diagram
GTAGPNQEQE + H2O
GTAGP + NQEQE
show the reaction diagram
-
-
-
-
?
GTSGPNQEQE + H2O
GTSGP + NQEQE
show the reaction diagram
-
-
-
-
?
H-(O2Oc)2-K(Abz)GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-Abz-GFGP-OH + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-Abz-GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGP-OH + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-(O2Oc)-HMBA-PEGA + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-(O2Oc)-HMBA-PEGA
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-(O2Oc)-NH2 + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-(O2Oc)-NH2
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-(O2Oc)2-HMBA-PEGA + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-(O2Oc)2-HMBA-PEGA
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-(O2Oc)2-NH2 + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-(O2Oc)2-NH2
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-HMBA-PEGA + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-HMBA-PEGA
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-F(p-NO2)GFGPFGK(Abz)A-NH2 + H2O
H-F(p-NO2)GFGP + FGK(Abz)A-NH2
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-FGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-K(Abz)-GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H-MDPVDPNIE-OH + H2O
?
show the reaction diagram
-
substrate specificity studies on membrane PE as compared with POP. ZPP-sensitive cleavage of both occurred
-
-
?
H-O2Oc-K(Abz)-GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
H2N-QLQPFPQPQLPY-OH + H2O
?
show the reaction diagram
-
substrate specificity studies on membrane PE as compared with POP. ZPP-sensitive cleavage of both occurred
-
-
?
hemoglobin beta-chain + H2O
?
show the reaction diagram
-
-
-
-
?
insulin + H2O
?
show the reaction diagram
ISRPPGFSPFR + H2O
ISRPP + GFSPFR
show the reaction diagram
-
-
-
?
L-Ala-L-Ala-L-Pro-4-nitroanilide + H2O
L-Ala-L-Ala-L-Pro + 4-nitroaniline
show the reaction diagram
Luliberin + H2O
?
show the reaction diagram
LVVYPWTQRF + H2O
LVVYP + WTQRF
show the reaction diagram
Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg + H2O
Lys-Arg-Pro-Pro + Gly-Phe-Ser-Pro-Phe-Arg
show the reaction diagram
-
as active as potentiator B
-
?
Me-O-succinyl-Ala-Ala-Val p-nitroanilide + H2O
Me-O-succinyl-Ala-Ala + Val p-nitroanilide
show the reaction diagram
-
-
-
?
melanotropin + H2O
?
show the reaction diagram
Met-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg + H2O
Met-Lys-Arg-Pro-Pro + Gly-Phe-Ser-Pro-Phe-Arg
show the reaction diagram
-
as active as potentiator B
-
?
N-benzoyl-L-Phe-L-Val-L-Arg-4-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
N-benzyloxycarbonyl-Ala-Ala-p-nitrophenyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
N-benzyloxycarbonyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
-
?
N-benzyloxycarbonyl-Gly-Pro-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-benzyloxycarbonyl-Gly-Pro-p-nitrophenyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
N-carbobenzoxy-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
N-carbobenzoxy-Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
N-carbobenzoxy-Gly-Pro-7-amido-4-methyl-coumarin + H2O
?
show the reaction diagram
-
-
-
-
?
N-carbobenzyloxy-Ala-Pro-2-naphthylamide + H2O
N-carbobenzyloxy-Ala-Pro + 2-naphthylamine
show the reaction diagram
N-carbobenzyloxy-glycyl-proline-4-methyloumarin-7-amide + H2O
N-carbobenzyloxy-glycyl-proline + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
N-Suc-Ala-Ala-Ala-7-amido-4-methylcoumarin + H2O
N-Suc-Ala-Ala-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
assay at pH 7.5, 25C
-
-
?
N-Suc-Gly-Pro-7-amido-4-methylcoumarin + H2O
N-Suc-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
assay at pH 7.5, 25C
-
-
?
N-Suc-Gly-Pro-Leu-Gly-Pro-7-amido-4-methylcoumarin + H2O
N-Suc-Gly-Pro-Leu-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
assay at pH 7.5, 25C
-
-
?
N-succinyl-Ala-Ala-Ala-4-nitroanilide
N-succinyl-Ala-Ala-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
-
N-succinyl-Ala-Pro-4-nitroanilide + H2O
N-succinyl-Ala-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
?
N-succinyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
24% of the activity with N-succinyl-Gly-L-Pro-L-Leu-Gly-L-Pro-7-amido-4-methylcoumarin
-
-
?
N-succinyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
N-succinyl-Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
N-succinyl-Gly-L-Pro-L-Leu-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
?
N-succinyl-Gly-Pro-7-amido-4-methylcoumarin + H2O
N-succinyl-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
N-succinyl-Gly-Pro-OH + H2O
?
show the reaction diagram
-
-
-
-
?
N-succinyl-glycyl-proline-4-methylcoumarin-7-amide + H2O
N-succinyl-glycyl-proline + 7-amino-4-methylcoumarin
show the reaction diagram
N-succinyl-glycyl-prolyl-7-amido-4-methylcoumarin + H2O
N-succinyl-glycyl-prolyl + 7-amino-4-methylcoumarin
show the reaction diagram
N-succinyl-L-Ala-L-Ala-L-Ala-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
13% of the activity with N-succinyl-Gly-L-Pro-L-Leu-Gly-L-Pro-7-amido-4-methylcoumarin
-
-
?
Nalpha-benzyl-Gly-Pro-Leu-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
Nalpha-benzyloxycarbonyl-Gly-Pro-Leu-Gly + H2O
?
show the reaction diagram
neurotensin + H2O
?
show the reaction diagram
oxytocin + H2O
?
show the reaction diagram
oxytocin + H2O
inactivated oxytocin + dipeptide
show the reaction diagram
-
-
-
?
oxytoxin + H2O
?
show the reaction diagram
PEGA(O2Oc)2-K(Abz)GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
PEGA-K(ABz)-GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
PEGA-O2Oc-K(Abz)GFGPFGF(p-NO2)A-NH2 + H2O
?
show the reaction diagram
-
assay at pH 8.0, 37C, reaction stopped by heating at 95C for 5 min
-
-
?
peptide QATVGDVNTDRPGLLDLK + H2O
TVGDVNTDRPGLLDLK + GDVNTDRPGLLDLK + QA + QATV
show the reaction diagram
-
i.e. octadecaneuropeptide ODN, the biologically active fragment of diazepam-binding inhibitor, the Ala2 residue is preferred by the enzyme for cleavage, while the Pro-Gly bind is not cleaved, overview
-
-
?
Peptides + H2O
?
show the reaction diagram
pGlu-Gly-Leu-Pro-Pro-Arg-Pro + H2O
pGlu-Gly-Leu-Pro-Pro + Arg-Pro
show the reaction diagram
-
i.e. potentiator B
-
?
pGlu-Gly-Leu-Pro-Pro-Gly-Pro + H2O
pGlu-Gly-Leu-Pro-Pro + Gly-Pro
show the reaction diagram
-
i.e. potentiator C, as active as potentiator B
-
?
RPKPQQFFGLM + H2O
L-Arg-L-Pro + L-Lys-L-Pro + QQFFGLM
show the reaction diagram
-
-
-
-
?
RPPGFSPFR + H2O
?
show the reaction diagram
-
i.e. bradykinin, 90% of the activity with potentiator B, i.e. pGlu-Gly-Leu-Pro-Pro-Arg-Pro
-
?
RPPGFSPFR-amide + H2O
RPP + GFSPFR-amide
show the reaction diagram
-
i.e. bradykinin, 70% of the activity with potentiator B, i.e. pGlu-Gly-Leu-Pro-Pro-Arg-Pro
-
?
somatostatin-28 (1-12) + H2O
?
show the reaction diagram
-
-
-
-
?
SPRY2 + H2O
?
show the reaction diagram
-
not an in vivo substrate of fibroblast activation protein
-
-
?
Substance P + H2O
?
show the reaction diagram
Suc-Gly-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
-
?
succinyl-Ala-Pro-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
succinyl-D-Ala-Pro-4-nitroanilide + H2O
benzyloxycarbonyl-D-Ala-Pro + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
succinyl-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
succinyl-Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
succinyl-Gly-Pro-4-methylcoumarin 7-amide + H2O
?
show the reaction diagram
succinyl-Gly-Pro-4-methylcoumaryl-7-amide + H2O
succinyl-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
succinyl-Gly-Pro-7-amido-4-methylcoumarin + H2O
succinyl-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
succinyl-Gly-Pro-Leu-Gly-Pro-4-methylcoumaryl-7-amide
?
show the reaction diagram
-
-
-
-
?
succinyl-Gly-Pro-Leu-Gly-Pro-methylcoumaryl-7-amide + H2O
?
show the reaction diagram
-
-
-
-
?
tasidotin + H2O
tert-butylamine + ?
show the reaction diagram
-
assay at pH 6.8, 37C
-
-
?
tau protein + H2O
?
show the reaction diagram
-
-
-
-
?
tert-butyloxycarbonyl-Ala-Ala p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
tert-butyloxycarbonyl-Ala-Ala-Pro-Ala p-nitroanilide + H2O
tert-butyloxycarbonyl-Ala-Ala-Pro + Ala + p-nitoaniline
show the reaction diagram
-
-
-
?
thymosin beta4 + H2O
acetyl-N-L-Ser-L-Asp-L-Lys-L-Pro + ?
show the reaction diagram
-
-
-
-
?
thymosin beta4 + H2O
acetyl-N-Ser-Asp-Lys-Pro + ?
show the reaction diagram
-
prolyl oligopeptidase is a second-step enzyme in the release of acetyl-N-Ser-Asp-Lys-Pro from thymosin beta4 and has autoregulatory effect in the first step
-
-
?
thyroliberin + H2O
?
show the reaction diagram
thyrotropin releasing hormone + H2O
?
show the reaction diagram
thyrotropin-releasing hormone + H2O
?
show the reaction diagram
-
-
-
-
?
tuftsin + H2O
?
show the reaction diagram
Tyr-Gln-Glu-Pro-Val-Leu-Gly-Pro-Val-Arg-Gly-Pro-Phe-Pro-Ile-Ile-Val-p-nitroanilide + H2O
?
show the reaction diagram
urotensin II + H2O
?
show the reaction diagram
-
human substrate, cleavage at the canonical post-proline site
-
-
?
Vasopressin + H2O
?
show the reaction diagram
vasopressin + H2O
inactivated vasopressin + dipeptide
show the reaction diagram
-
-
-
?
VHLTPVGL + H2O
VHLTP + VGL
show the reaction diagram
-
-
-
?
Z-Gly-L-Pro-4-nitroanilide + H2O
Z-Gly-L-Pro + 4-nitroaniline
show the reaction diagram
Z-Gly-L-Pro-7-amido-4-methylcoumarin + H2O
Z-Gly-L-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
Z-Gly-Pro-2-naphthylamide + H2O
Z-Gly-Pro + 2-naphthylamine
show the reaction diagram
Z-Gly-Pro-4-nitroanilide + H2O
4-nitroaniline + Z-Gly-Pro
show the reaction diagram
-
pH 7.0, room temperature
-
-
?
Z-Gly-Pro-4-nitroanilide + H2O
Z-Gly-Pro + p-nitroaniline
show the reaction diagram
Z-Gly-Pro-4-nitroanilide + H2O
Z-glycyl-L-proline + 4-nitroaniline
show the reaction diagram
-
assay at pH 7.0, 30C
-
-
?
Z-Gly-Pro-7-amido-4-methylcoumarin
Z-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
Z-Gly-Pro-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
-
?
Z-Gly-Pro-7-amido-4-methylcoumarin + H2O
z-Gly-Pro + 7-amino-4-methylcoumarin
show the reaction diagram
Z-Gly-Pro-p-nitroanilide + H2O
Z-Gly-Pro + p-nitroaniline
show the reaction diagram
-
-
-
-
?
Z-L-Ala-L-Ala-L-Ala-L-Pro-4-nitroanilide + H2O
Z-L-Ala-L-Ala-L-Ala-L-Pro + 4-nitroaniline
show the reaction diagram
additional information
?
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
alpa2-antiplasmin + H2O
?
show the reaction diagram
-
not a robust substrate in vitro, the enzyme cleaves after Pro12 in the T9S10G11P12-N13 Q14E15Q16E17 sequence
-
-
?
alpha-melanocyte-stimulating hormone + H2O
?
show the reaction diagram
alpha-synuclein + H2O
?
show the reaction diagram
-
-
-
-
?
alpha-synulein + H2O
?
show the reaction diagram
-
the enzyme binds to alpha-synuclein and enhances its dimerization
-
-
?
Angiotensin I + H2O
?
show the reaction diagram
Angiotensin II + H2O
?
show the reaction diagram
arginine-vasopressin + H2O
?
show the reaction diagram
beta-amyloid + H2O
?
show the reaction diagram
-
-
-
-
?
beta-endorphin + H2O
?
show the reaction diagram
Bradykinin + H2O
?
show the reaction diagram
bradykinin potentiating peptide + H2O
?
show the reaction diagram
casein + H2O
?
show the reaction diagram
-
-
-
-
?
Collagen + H2O
?
show the reaction diagram
collagens + H2O
?
show the reaction diagram
-
in host extracellular matrix
-
-
?
Fibronectin + H2O
?
show the reaction diagram
gliadins + H2O
?
show the reaction diagram
-
in host gut
-
-
?
gluten + H2O
?
show the reaction diagram
gluten peptide + H2O
?
show the reaction diagram
gluten peptides + H2O
?
show the reaction diagram
gonadotropin releasing hormone + H2O
?
show the reaction diagram
Luliberin + H2O
?
show the reaction diagram
LVVYPWTQRF + H2O
LVVYP + WTQRF
show the reaction diagram
-
prolyl endopeptidase activity could be the first step of the degradation of LVV-hemorphin-7
-
?
melanotropin + H2O
?
show the reaction diagram
neurotensin + H2O
?
show the reaction diagram
oxytocin + H2O
?
show the reaction diagram
oxytoxin + H2O
?
show the reaction diagram
Peptides + H2O
?
show the reaction diagram
Substance P + H2O
?
show the reaction diagram
tau protein + H2O
?
show the reaction diagram
-
-
-
-
?
thymosin beta4 + H2O
acetyl-N-L-Ser-L-Asp-L-Lys-L-Pro + ?
show the reaction diagram
-
-
-
-
?
thyroliberin + H2O
?
show the reaction diagram
thyrotropin releasing hormone + H2O
?
show the reaction diagram
tuftsin + H2O
?
show the reaction diagram
urotensin II + H2O
?
show the reaction diagram
-
human substrate, cleavage at the canonical post-proline site
-
-
?
Vasopressin + H2O
?
show the reaction diagram
additional information
?
-