Information on EC 3.4.18.1 - cathepsin X

Word Map on EC 3.4.18.1
Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Specify your search results
Select one or more organisms in this record:
Show additional data
Do not include text mining results
Include (text mining) results (more...)
Include results (AMENDA + additional results, but less precise; more...)

The enzyme appears in viruses and cellular organisms

EC NUMBER
COMMENTARY hide
3.4.18.1
-
RECOMMENDED NAME
GeneOntology No.
cathepsin X
-
REACTION
REACTION DIAGRAM
COMMENTARY hide
ORGANISM
UNIPROT
LITERATURE
Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity
show the reaction diagram
REACTION TYPE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
hydrolysis of peptide bond
CAS REGISTRY NUMBER
COMMENTARY hide
37217-21-3
-
ORGANISM
COMMENTARY hide
LITERATURE
UNIPROT
SEQUENCE DB
SOURCE
CTPZ; gene CTPZ
SwissProt
Manually annotated by BRENDA team
-
-
-
Manually annotated by BRENDA team
-
UniProt
Manually annotated by BRENDA team
GENERAL INFORMATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
malfunction
-
cathepsin X prevents an effective immune response against Helicobacter pylori infection of THP-1 cells, overview
physiological function
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
(2,4-dinitrophenyl)-GFFGW + H2O
(2,4-dinitrophenyl)-GFFG + L-Trp
show the reaction diagram
-
-
-
?
(2,4-dinitrophenyl)-GFFRW + H2O
(2,4-dinitrophenyl)-GFFR + L-Trp
show the reaction diagram
-
-
-
?
(2,4-dinitrophenyl)-GFFW + H2O
(2,4-dinitrophenyl)-GFF + L-Trp
show the reaction diagram
-
-
-
?
(2,4-dinitrophenyl)-GFRW + H2O
(2,4-dinitrophenyl)-GFR + L-Trp
show the reaction diagram
-
-
-
?
(2,4-dinitrophenyl)-GRFFW + H2O
(2,4-dinitrophenyl)-GRF + L-Phe-L-Trp
show the reaction diagram
-
-
-
?
(2,4-dinitrophenyl)-GRFFW + H2O
(2,4-dinitrophenyl)-GRFF + L-Trp
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFF + H2O
(2-aminobenzoyl)-FF + L-Phe
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFFA + H2O
(2-aminobenzoyl)-FFF + L-Ala
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFFP + H2O
(2-aminobenzoyl)-FFF + Pro
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFFR + H2O
(2-aminobenzoyl)-FFF + L-Arg
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFFR-NH2 + H2O
(2-aminobenzoyl)-FFF + Arg-amide
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFFW + H2O
(2-aminobenzoyl)-FFF + L-Trp
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFGW + H2O
(2-aminobenzoyl)-FFG + L-Trp
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFRW + H2O
(2-aminobenzoyl)-FFR + L-Trp
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FFRW-NH2 + H2O
(2-aminobenzoyl)-FFR + L-Trp-amide
show the reaction diagram
-
-
-
?
(2-aminobenzoyl)-FRFW-NH2 + H2O
(2-aminobenzoyl)-FR + Phe-Trp-amide
show the reaction diagram
-
-
-
?
2-aminobenzoyl-Ala-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ala-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 20/mM * s
-
-
?
2-aminobenzoyl-Arg-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Arg-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 5.2/mM * s
-
-
?
2-aminobenzoyl-Asn-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Asn-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 17/mM * s
-
-
?
2-aminobenzoyl-Asp-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Asp-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 16/mM * s
-
-
?
2-aminobenzoyl-Cys-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Cys-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 11/mM * s
-
-
?
2-aminobenzoyl-Gln-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Gln-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 43/mM * s
-
-
?
2-aminobenzoyl-Glu-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Glu-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 27/mM * s
-
-
?
2-aminobenzoyl-Gly-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Gly-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 4.4/mM * s
-
-
?
2-aminobenzoyl-His-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-His-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 4.7/mM * s
-
-
?
2-aminobenzoyl-Ile-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ile-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 2.7/mM * s
-
-
?
2-aminobenzoyl-Leu-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Leu-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 153/mM * s
-
-
?
2-aminobenzoyl-Lys-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Lys-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 5.7/mM * s
-
-
?
2-aminobenzoyl-Met-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Met-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 28/mM * s
-
-
?
2-aminobenzoyl-Phe-Ala-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ala + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 51/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 100/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Ala + H2O
2-aminobenzoyl-Phe-Arg + Ala
show the reaction diagram
kcat/Km is 10/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Arg + H2O
2-aminobenzoyl-Phe-Arg + Arg
show the reaction diagram
kcat/Km is 1.7/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Asn + H2O
2-aminobenzoyl-Phe-Arg + Asn
show the reaction diagram
kcat/Km is 5.9/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Asp + H2O
2-aminobenzoyl-Phe-Arg + Asp
show the reaction diagram
kcat/Km is 8.9/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Cys + H2O
2-aminobenzoyl-Phe-Arg + Cys
show the reaction diagram
kcat/Km is 73/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Gln + H2O
2-aminobenzoyl-Phe-Arg + Gln
show the reaction diagram
kcat/Km is 4.9/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Glu + H2O
2-aminobenzoyl-Phe-Arg + Glu
show the reaction diagram
kcat/Km is 7.7/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Gly + H2O
2-aminobenzoyl-Phe-Arg + Gly
show the reaction diagram
kcat/Km is 14/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-His + H2O
2-aminobenzoyl-Phe-Arg + His
show the reaction diagram
kcat/Km is 5.4/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Ile + H2O
2-aminobenzoyl-Phe-Arg + Ile
show the reaction diagram
kcat/Km is 3.4/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Leu + H2O
2-aminobenzoyl-Phe-Arg + Leu
show the reaction diagram
kcat/Km is 7.1/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Lys + H2O
2-aminobenzoyl-Phe-Arg + Lys
show the reaction diagram
kcat/Km is 5.3/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Met + H2O
2-aminobenzoyl-Phe-Arg + Met
show the reaction diagram
kcat/Km is 9.3/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Phe + H2O
2-aminobenzoyl-Phe-Arg + Phe
show the reaction diagram
kcat/Km is 15/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Ser + H2O
2-aminobenzoyl-Phe-Arg + Ser
show the reaction diagram
kcat/Km is 48/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Thr + H2O
2-aminobenzoyl-Phe-Arg + Thr
show the reaction diagram
kcat/Km is 5.8/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Trp + H2O
2-aminobenzoyl-Phe-Arg + Trp
show the reaction diagram
kcat/Km is 8.6/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Tyr + H2O
2-aminobenzoyl-Phe-Arg + Tyr
show the reaction diagram
kcat/Km is 8.8/mM * s
-
-
?
2-aminobenzoyl-Phe-Arg-Val + H2O
2-aminobenzoyl-Phe-Arg + Val
show the reaction diagram
kcat/Km is 5.9/mM * s
-
-
?
2-aminobenzoyl-Phe-Asn-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Asn + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 13/mM * s
-
-
?
2-aminobenzoyl-Phe-Asp-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Asp + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 12/mM * s
-
-
?
2-aminobenzoyl-Phe-Cys-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Cys + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 17/mM * s
-
-
?
2-aminobenzoyl-Phe-Gln-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Gln + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 73/mM * s
-
-
?
2-aminobenzoyl-Phe-Glu-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Glu + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 62/mM * s
-
-
?
2-aminobenzoyl-Phe-Gly-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Gly + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 45/mM * s
-
-
?
2-aminobenzoyl-Phe-His-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-His + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 3.5/mM * s
-
-
?
2-aminobenzoyl-Phe-Ile-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ile + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 4.3/mM * s
-
-
?
2-aminobenzoyl-Phe-Leu-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Leu + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 2.0/mM * s
-
-
?
2-aminobenzoyl-Phe-Lys-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Lys + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 79/mM * s
-
-
?
2-aminobenzoyl-Phe-Met-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Met + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 181/mM * s
-
-
?
2-aminobenzoyl-Phe-Phe-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Phe + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 108/mM * s
-
-
?
2-aminobenzoyl-Phe-Ser-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Ser + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 32/mM * s
-
-
?
2-aminobenzoyl-Phe-Thr-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Thr + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 68/mM * s
-
-
?
2-aminobenzoyl-Phe-Trp-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Trp + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 1.3/mM * s
-
-
?
2-aminobenzoyl-Phe-Tyr-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Tyr + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 58/mM * s
-
-
?
2-aminobenzoyl-Phe-Val-4-nitrophenylalanine + H2O
2-aminobenzoyl-Phe-Val + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 4.8/mM * s
-
-
?
2-aminobenzoyl-Pro-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Pro-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 0.2/mM * s
-
-
?
2-aminobenzoyl-Ser-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Ser-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 8.2/mM * s
-
-
?
2-aminobenzoyl-Thr-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Thr-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 8.7/mM * s
-
-
?
2-aminobenzoyl-Trp-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Trp-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 12/mM * s
-
-
?
2-aminobenzoyl-Tyr-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Tyr-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 400/mM * s
-
-
?
2-aminobenzoyl-Val-Arg-4-nitrophenylalanine + H2O
2-aminobenzoyl-Val-Arg + 4-nitrophenylalanine
show the reaction diagram
kcat/Km is 31/mM * s
-
-
?
3-aminobenzoyl-FR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-FR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
show the reaction diagram
-
-
-
?
3-aminobenzoyl-LR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-LR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
show the reaction diagram
-
-
-
?
3-aminobenzoyl-RR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P + H2O
3-aminobenzoyl-RR + (2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
show the reaction diagram
-
-
-
?
7-methoxycoumarin-4-ylacetyl-RPPGFSAFK-N-epsilon-2,4-dinitrophenol + H2O
?
show the reaction diagram
-
fluorescence cathepsin X/A-selective substrate
-
-
?
Abz-Phe-Glu-Lys(Dnp)-OH + H2O
?
show the reaction diagram
-
-
-
-
?
AKYNQLMRIEEELGEEARFAGHNFRNPSVL + H2O
?
show the reaction diagram
-
a model peptide derived from rat gamma-enolase carboxyl terminal, overview
-
-
?
Ala-Ala-Phe-7-amido-4-methylcoumarin + H2O
Ala-Ala-Phe + 7-amino-4-methylcoumarin
show the reaction diagram
61% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
-
-
?
alpha-enolase + H2O
?
show the reaction diagram
benzyloxycarbonyl-Arg-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Arg-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
34% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
-
-
?
benzyloxycarbonyl-FR-4-methylcoumaryl-7-amide + H2O
benzyloxycarbonyl-FR + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Leu-Leu-Glu-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Leu-Leu-Glu + 7-amino-4-methylcoumarin
show the reaction diagram
54% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
-
-
?
benzyloxycarbonyl-Phe-Arg-4-methylcoumarin-7-amide + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Phe-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
benzyloxycarbonyl-RR-4-methylcoumaryl-7-amide + H2O
benzyloxycarbonyl-RR + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
benzyloxycarbonyl-Val-Val-Arg-7-amido-4-methylcoumarin + H2O
benzyloxycarbonyl-Val-Val-Arg + 7-amino-4-methylcoumarin
show the reaction diagram
12% of the activity with benzyloxycarbonyl-Phe-Arg-7-amido-4-methylcoumarin
-
-
?
biotinyl-KKQ20KK + H2O
?
show the reaction diagram
-
-
within the lysosome, the major endoprotease, cathepsin L, carries out an initial attack within the polyglutamine repeat, which generates new C termini, facilitating the actions of the carboxypeptidase cathepsin Z. Extracts containing both cathespin L and Z show multiple cleavages within the polyglutamine sequence of biotinyl-KKQ20KK, generating a variety of fragments, including biotinyl-KKQ4,biotinyl-KKQ8, Q12KK, andQ16KK
-
?
Bradykinin + H2O
?
show the reaction diagram
-
the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
-
-
?
Bradykinin + H2O
Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe + Arg
show the reaction diagram
-
i.e. Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg, a mainly B2 receptor
an exclusive B1 receptor
-
?
CXCL-12 + H2O
?
show the reaction diagram
gamma-enolase + H2O
?
show the reaction diagram
Glucagon + H2O
?
show the reaction diagram
-
-
-
-
?
Hemoglobin + H2O
?
show the reaction diagram
-
-
-
-
?
Hippuryl-L-Arg + H2O
Hippuric acid + L-Arg
show the reaction diagram
-
-
-
-
?
hippuryl-L-glutamic acid + H2O
hippuric acid + L-Glu
show the reaction diagram
-
-
-
-
?
KAKFAGRNPRNPLAK + H2O
?
show the reaction diagram
-
a model peptide derived from human alpha-enolase carboxyl terminal, overview
-
-
?
kallidin + H2O
?
show the reaction diagram
-
the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
-
-
?
kallidin + H2O
Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe + Arg
show the reaction diagram
-
i.e. Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg, a mainly B2 receptor
an exclusive B1 receptor
-
?
lymphocyte function associated antigen-1 + H2O
?
show the reaction diagram
Proteins + H2O
?
show the reaction diagram
-
-
-
-
-
Z-Arg-Arg-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
?
Z-Phe-Arg-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
-
-
-
?
additional information
-
-
NATURAL SUBSTRATES
NATURAL PRODUCTS
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
REVERSIBILITY
r=reversible
ir=irreversible
?=not specified
alpha-enolase + H2O
?
show the reaction diagram
-
cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity
-
-
?
Bradykinin + H2O
?
show the reaction diagram
-
the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
-
-
?
CXCL-12 + H2O
?
show the reaction diagram
-
CXCL-12 is a physiological substrate for secreted cathepsin X
-
-
?
gamma-enolase + H2O
?
show the reaction diagram
-
cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity
-
-
?
kallidin + H2O
?
show the reaction diagram
-
the peptide is converted from a bradykinin B2 receptor ligand to a bradykinin B1 receptor specific ligand
-
-
?
lymphocyte function associated antigen-1 + H2O
?
show the reaction diagram
-
cathepsin X cleaves the beta2 cytoplasmic tail of LFA-1 inducing the intermediate affinity form of LFA-1 and alpha-actinin-1 binding. Cleavage by cathepsin X of the amino acid residues S769, E768 and A767 from the C-terminal of the b2 cytoplasmic tail of LFA-1 promotes binding of the actin-binding protein a-actinin-1
-
-
?
Proteins + H2O
?
show the reaction diagram
-
-
-
-
-
additional information
?
-
INHIBITORS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
1,10-phenanthroline
antipain
Aprotinin
0.1 mM, proPoCtX: 31.9% inhibition, native PoCtX: 51.3% inhibition
CA-074
-
-
chicken cystatin
-
-
-
chymostatin
0.1 mM, proPoCtX: 35.4% inhibition, native PoCtX: 96.9% inhibition
Co2+
1 mM, 71% inhibition
Cu2+
1 mM, 93% inhibition
cystatin C
-
-
-
E-64
0.1 mM, proPoCtX: 25.6% inhibition, native PoCtX: 98.6% inhibition
E64
treatment of cumulus-oocyte-complexes with E64 enhances subsequent rates of blastocyst development following parthenogenetic activation
GFG-semicarbazone
-
-
Hg2+
1 mM, 90% inhibition
leupeptin
0.1 mM, proPoCtX: 99.1% inhibition, native PoCtX: 95.6% inhibition
N-ethylmaleimide
0.1 mM, 86% inhibition
NEM
0.1 mM, proPoCtX: 44.6% inhibition, native PoCtX: 67.0% inhibition
p-hydroxymercuribenzoate
-
-
pepstatin A
0.1 mM, proPoCtX: 0% inhibition, native PoCtX: 36.0% inhibition
PMSF
0.1 mM, proPoCtX: 42.2% inhibition, native PoCtX: 37.2% inhibition
sodium dodecylsulfate
0.01%, 15.6% residual activity
Stefin A
-
-
-
additional information
-
ACTIVATING COMPOUND
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
Brij 35
0.01%, 125% of initial activity
KCl
1 mM, 116% of initial activity
Triton X-100
0.01%, 123% of initial activity
Tween 20
0.01%, 130% of initial activity
additional information
-
CagA, upregulation of CTSX is more intense in tissue samples of patients with CagA+ Helicobacter pylori than in those with CagA- Helicobacter pylori
-
KM VALUE [mM]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.0018
(2,4-dinitrophenyl)-GFFGW
-
pH 5.1, 37°C
0.0036
(2,4-dinitrophenyl)-GFFRW
-
pH 5.1, 37°C
0.001
(2,4-dinitrophenyl)-GFFW
-
pH 5.1, 37°C
0.0024
(2,4-dinitrophenyl)-GFRFW
-
pH 5.1, 37°C
0.0042
(2,4-dinitrophenyl)-GFRW
-
pH 5.1, 37°C
0.0046
(2,4-dinitrophenyl)-GRFFW
-
pH 5.1, 37°C
0.063
CBZ-FR-7-amido-4-methylcoumarin
-
pH 5.1, 37°C
0.13
CBZ-RR-7-amido-4-methylcoumarin
-
pH 5.1, 37°C
0.5
glucagon
-
-
0.69
hippuryl-L-Arg
-
D253R mutant
0.0037
ortho-aminobenzoyl-FR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
pH 5.1, 37°C
0.0105
ortho-aminobenzoyl-LR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
pH 5.1, 37°C
0.0083
ortho-aminobenzoyl-RR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
-
pH 5.1, 37°C
TURNOVER NUMBER [1/s]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.007
(2,4-dinitrophenyl)-GFFGW
Homo sapiens
-
pH 5.1, 37°C
0.3
(2,4-dinitrophenyl)-GFFRW
Homo sapiens
-
pH 5.1, 37°C
0.07
(2,4-dinitrophenyl)-GFFW
Homo sapiens
-
pH 5.1, 37°C
0.03
(2,4-dinitrophenyl)-GFRFW
Homo sapiens
-
pH 5.1, 37°C
0.7
(2,4-dinitrophenyl)-GFRW
Homo sapiens
-
pH 5.1, 37°C
0.23
(2,4-dinitrophenyl)-GRFFW
Homo sapiens
-
pH 5.1, 37°C
0.07
2-aminobenzoyl-FR-/-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
Homo sapiens
-
pH 5.1, 37°C
0.02
2-aminobenzoyl-LR-/-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
Homo sapiens
-
pH 5.1, 37°C
0.06
2-aminobenzoyl-RR-/-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
Homo sapiens
-
pH 5.1, 37°C
0.22
benzyloxycarbony-FR-4-methylcoumaryl-7-amide
Homo sapiens
-
pH 5.1, 37°C
0.63 - 6.08
benzyloxycarbony-RR-4-methylcoumaryl-7-amide
kcat/KM VALUE [1/mMs-1]
SUBSTRATE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
4.17
bradykinin
Homo sapiens
-
pH 5.5
466
5.75
kallidin
Homo sapiens
-
pH 5.5
3696
Ki VALUE [mM]
INHIBITOR
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
IMAGE
0.000015
chicken cystatin
-
pH 5.5, 25°C
-
0.000012
cystatin C
-
pH 5.5, 25°C
-
0.0166
GFG-semicarbazone
-
pH 5.5, 25°C
0.0000017
Stefin A
-
pH 5.5, 25°C
-
SPECIFIC ACTIVITY [µmol/min/mg]
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
10 - 15
-
-
12 - 15
-
-
364.5
cytosol extract
3457
DEAE-Sephagel, 9.48fold purification
additional information
-
at day 8 after 5th lumbar spinal nerve transection, CATX activity increases strongly and highly significant in the lumbar segment (59% compared to sham operated animals, 90% compared to naive); expression and activity of CATX is upregulated in the spinal cord during the development and progression of neuropathic pain in the CNS of the rat 5th lumbar spinal nerve transection model after lesion, the strongest increase in protein content is found in the thoracic segment (87.4%)
pH OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
4 - 5.5
-
-
4.4
-
-
5 - 5.5
-
reaction with benzyloxycarbonyl-RR-4-methylcoumaryl-7-amide
5 - 6
-
reaction with (2,4-dinitrophenyl)-GFFW
5.2 - 5.5
-
-
5.5
-
assay at
5.5 - 5.6
-
-
6
native PoCtX protein
pH RANGE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
3.5 - 5.5
-
pH 3.5: about 50% of maximal activity, pH 5.5: about 50% of maximal activity, reaction with 3-aminobenzoyl-FR-(2,3-diaminopropionyl)-(2,4-dinitrophenyl)-P
4 - 6.5
-
pH 4.0: about 45% of maximal activity, reaction with benzyloxycarbonyl-RR-methylcoumarinamide
4.5 - 6.5
-
pH 4.5: about 45% of maximal activity, pH 6.5: about 10% of maximal activity, reaction with (2,4-dinitrophenyl)-GFFW
TEMPERATURE OPTIMUM
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
pI VALUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
5.1
-
isoelectric focusing
SOURCE TISSUE
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
SOURCE
-
cathepsin X can be secreted by nonhematopoietic bone marrow cells in an activated form
Manually annotated by BRENDA team
-
an osteoblastic cell line
Manually annotated by BRENDA team
-
healthy, aging, and pathological, expression patterns of cathepsin X, overview
Manually annotated by BRENDA team
-
upregulation in gastric cancer compared to non-neoplastic mucosa. Patients with Helicobacter pylori gastritis show significantly higher cathepsin X mRNA (2.5fold) and protein (1.6fold) expression than Helicobacter pylori-negative partients
Manually annotated by BRENDA team
-
a bone marrow stromal cell line
Manually annotated by BRENDA team
-
a bone marrow stromal cell line
Manually annotated by BRENDA team
-
protein level of cathespin X does not differ significantly between matched pairs of lung tumor and adjacent lung tissue ontained from patients with lung cancer
Manually annotated by BRENDA team
-
human gastric epithelial cell
Manually annotated by BRENDA team
-
very low enzyme content
Manually annotated by BRENDA team
enzyme mRNA accumulation during maturation
Manually annotated by BRENDA team
cumulus cells surrounding germinal vesicle oocytes harvested from adult versus prepubertal animals, developmental expression profile, overview, the enzyme expression is severalfold higher in prepubertal cells
Manually annotated by BRENDA team
-
primary
Manually annotated by BRENDA team
-
the enzyme accumulates in vesicles at lamellipodia
Manually annotated by BRENDA team
additional information
LOCALIZATION
ORGANISM
UNIPROT
COMMENTARY hide
GeneOntology No.
LITERATURE
SOURCE
-
luminal protein-protein interactions between components of the cargo system in the endoplasmic reticulum for secretion of cargo proteins, e.g. cathepsin C or cathepsin Z, involve the cargo transport receptor ERGIC-53, i.e. endoplasmic reticulum-Golgi intermediate compartment protein of 53 kDa, with its luminal interaction partner MCFD2, i.e. multiple coagulation factor deficiency protein 2, overview
Manually annotated by BRENDA team
dislocation of CTPZ from the cortical granules
Manually annotated by BRENDA team
-
secretion
-
Manually annotated by BRENDA team
-
luminal protein-protein interactions between components of the cargo system in the endoplasmic reticulum for secretion of cargo proteins, e.g. cathepsin C or cathepsin Z, involve the cargo transport receptor ERGIC-53, i.e. endoplasmic reticulum-Golgi intermediate compartment protein of 53 kDa, with its luminal interaction partner MCFD2, i.e. multiple coagulation factor deficiency protein 2, overview
Manually annotated by BRENDA team
association with, after fertilization
Manually annotated by BRENDA team
additional information
MOLECULAR WEIGHT
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
28000
x * 28000, recombinant enzyme, SDS-PAGE
32700
x * 32700, calculated
33200
native PoCtX protein
34000
-
proform of CATX, confirmed by Western blot analysis
52000
-
gel filtration
SUBUNITS
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
POSTTRANSLATIONAL MODIFICATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
glycoprotein
proteolytic modification
Crystallization/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
sitting-drop vapour diffusion, structure determined at 2.67 A resolution
-
pH STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
4 - 6
-
-
36443
TEMPERATURE STABILITY
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
STORAGE STABILITY
ORGANISM
UNIPROT
LITERATURE
0-4°C, dialysed, pH 5.3, 1 week
-
3°C, 0.15 M NaCl, pH 6.8, 7 weeks
-
Purification/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
purified 9.48fold via a one-step purification process using a DEAE-Sephagel HPLC column
recombinant enzyme from Pichia pastoris by cation exchange chromatography
-
recombinant GST-tagged enzyme from Escherichia coli strain BL21 by glutathione affinity and anion exchange chromatography
Cloned/COMMENTARY
ORGANISM
UNIPROT
LITERATURE
cathepsin X stable expression in Jurkat T cells
-
cDNA encoding for the proenzyme of PoCtX (proPoCtX) is expressed in Escherichia coli as a 57 kDa fusion protein with glutathione S-transferase
DNA and amino acid sequence determination and analysis, expression analysis, expression of GST-tagged enzyme in Escherichia coli strain BL21
DNA and amino acid sequence determination and anaylsis, expression of wild-type and mutant procathepsin X
-
expression in Escherichia coli
expression in Pichia pastoris
-
expression of procathepsin X in Pichia pastoris as an alpha-factor fusion
-
expression of recombinants in Escherichia coli
-
expression of the proenzyme in Pichia pastoris
-
gene CTSZ, cloning from cumulus cells surrounding oocytes, DNA and amino acid sequence determination, and expression anaylsis
genotype distributions of CTSZ and CTSZ3P in South African coloured population in metropolitan Cape Town, South Africa, genotyping, overview
EXPRESSION
ORGANISM
UNIPROT
LITERATURE
Helicobacter pylori antigens from subjects with gastritis, who are successful in eradicating the infection after antibiotic therapy, decrease the membrane expression of cathepsin X in THP-1 cells
-
Helicobacter pylori antigens from subjects with gastritis, who are unsuccessful in eradicating the infection after antibiotic therapy, increase the membrane expression of cathepsin X in THP-1 cells
-
ENGINEERING
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
D253K
-
reversed polarity and improved activity
D253R
-
reversed polarity and improved activity
G251T/D253K
-
double mutant, improved activity
additional information
APPLICATION
ORGANISM
UNIPROT
COMMENTARY hide
LITERATURE
diagnostics