Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
Please wait a moment until the data is sorted. This message will disappear when the data is sorted.
Abz-TEGEARGSVI-Dap(2,4-dinitrophenyl)-KK + H2O
?
-
-
-
-
?
aggrecan + H2O
2 aggrecan fragment
aggrecan + H2O
7 aggregan fragment
several cleavage sites are determined
product determination, overview
?
aggrecan + H2O
fragment 74ALGS + ?
-
-
-
-
?
aggrecan-interglobular domain + H2O
?
alpha2-macroglobulin + H2O
?
-
-
-
-
?
biglycan + H2O
?
-
-
-
-
?
brevican + H2O + H2O
?
-
-
-
-
?
C6-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-Gly-Thr-Lys(Mca)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(Dnp)-Gly-Ile-Ser-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-NH2 + H2O
?
-
-
-
-
?
carboxymethylated transferrin + H2O
?
-
-
-
-
?
decorin + H2O
?
-
-
-
-
?
FAM-AELQGRPISIAK-TAMRA + H2O
?
-
activity measured using a quenched fluorescent substrate
-
-
?
fibromodulin + H2O
29000 Da fibromodulin fragment + ?
-
very low activity
-
-
?
fibromodulin + H2O
?
-
-
-
-
?
Fibronectin + H2O
?
-
-
-
-
?
Gelatin + H2O
?
-
weak activity
-
-
?
K(6FAM)-DVQEFRGVTAVIRC(Qsy9)-KGK + H2O
K-(6FAM)-DVQE + FRGVTAVIRC(Qsy9)-KGK
-
-
-
-
?
K-[6FAM]-DVQEFRGVTAVIRC-[Qsy9]-KGK + H2O
K-[6FAM]-DVQE + FRGVTAVIRC-[Qsy9]-KGK
-
-
-
?
Lys(7-methoxycoumarin-4-yl)-Lys-Gln-Glu-Phe-Arg-Gly-Gln-Thr-Lys(Dnp)-NH2 + H2O
?
-
-
-
-
?
Lys(carboxyfluorescein)-Asp-Val-Gln-Glu-Phe-Arg-Gly-Val-Thr-Ala-Val-Ile-Arg-Lys(tetramethylrhodamine)-Lys-Gly-Lys-NH2 + H2O
?
-
-
-
-
?
matrilin-2 + H2O
?
-
substrate contains two putative cleavage sites. The first site is located between residues D851 and L852 in the middle of the domain and the second at the boundary with the coiled-coil domain at the C-terminus. Deletion of the entire unique domain eliminates the proteolysis of matrilin-2. The first cleavage site is present in all matrilin-2 oligomers, the second cleavage site becomes apparent only in the matrilin-2 hetero-oligomers with matrilin-1 or matrilin-3
-
?
matrilin-4 + H2O
?
-
matrilin-4 is specifically cleaved by ADAMTS-5
-
-
?
o-aminobenzoyl-Thr-Glu-Ser-Glu-Ser-Arg-Gly-Ala-Ile-Tyr-(N-3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-Lys-Lys-NH2 + H2O
o-aminobenzoyl-Thr-Glu-Ser-Glu + Ser-Arg-Gly-Ala-Ile-Tyr-(N-3-[2,4-dinitrophenyl]-L-2,3-diaminopropionyl)-Lys-Lys-NH2
-
recombinant ADAMTS-5 cleaves this substrate more readily than ADAMTS-4 in vitro
-
-
?
versican + H2O + H2O
fragment DPEAAE441 + ?
-
-
-
-
?
VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG + H2O
?
-
43mer peptide substrate
-
-
?
additional information
?
-
aggrecan + H2O
2 aggrecan fragment
-
cleavage site is Glu373-Ala374
-
?
aggrecan + H2O
2 aggrecan fragment
-
cleavage site is Glu373-Ala374, reaction is relevant to cartilage degeneration in inflammatory joint diseases
-
?
aggrecan + H2O
?
-
-
-
-
?
aggrecan + H2O
?
substrate from cartilage, N-terminal cleavage sites between glutamate and small uncharged aliphatic amino acids in nonglycosylated regions of the aggregan core protein: the interglobular domain E373-A, and within the chondroitinsulfate 2 attachment region E1666-G, E1771-A, and E1871-L
-
?
aggrecan + H2O
?
enzyme may play a role in cartilage breakdown
-
?
aggrecan + H2O
?
-
-
-
-
?
aggrecan + H2O
?
-
cleavage site is Glu373-Ala374
-
?
aggrecan + H2O
?
-
cleavage site is Glu373-Ala374
-
?
aggrecan + H2O
?
-
cleavage site is Glu373-Ala374, other cleavage sites are Glu1545-Gly1546, Glu1819-Ala1820, and Glu1919-Leu1920
-
?
aggrecan + H2O
?
-
substrate from cartilage, extensive digestion, N-terminal cleavage sites between glutamate and small uncharged aliphatic amino acids in nonglycosylated regions of the aggregan core protein: the interglobular domain E373-A, and between chondroitin sulfate attachment sites 1 and 2 E1480-G
-
?
aggrecan + H2O
?
-
degradation of cartilage matrix
-
?
aggrecan + H2O
?
-
enzyme may play a role in cartilage breakdown
-
?
aggrecan + H2O
?
-
ADAMTS-5 is able to cleave aggrecan core protein about 1,000 times more effectively than ADAMTS-4
-
-
?
aggrecan + H2O
?
-
cleavage at Glu373-Ala374 bond
-
-
?
aggrecan + H2O
?
-
2 microg, 90 min, reaction stopped by addition of 21 mM EDTA
-
-
?
aggrecan + H2O
?
-
2mg/ml, assay at 37°C, 16 h
-
-
?
aggrecan + H2O
?
ADAMTS-4 and ADAMTS-5 are the proteases responsible for the endogenous aggrecanase activity observed in IL-1beta stimulated bovine cartilage
-
-
?
aggrecan + H2O
?
-
aggrecan cleavage by a disintegrin and metalloproteinase with a thrombospondin type 1 motif, member 5 (ADAMTS-5) is crucial for the breakdown of cartilage matrix during osteoarthritis, a degenerative joint disease that leads to the progressive destruction of articular structures
-
-
?
aggrecan + H2O
?
cleavage at the Glu373-Ala374 site of aggrecan is measured
-
-
?
aggrecan + H2O
?
-
recombinant bovine aggrecan mutated at amino acids N-terminal or C-terminal to the interglobular domain cleavage site. Identification of multiple conserved amino acids within regions N- and C-terminal to the site of scission that may influence enzyme-substrate recognition, and may interact with exosites on ADAMTS-5. The S377Q mutant is extremely resistant to cleavage at Glu373-Ala374 by ADAMTS-5. Cleavage of S377T with ADAMTS-5 is also significantly inhibited compared to wild-type. The other P4'-mutant digests are similar to wild-type. Gln or Thr at the P4' position are inhibitory to ADAMTS-5 cleavage
-
-
?
aggrecan + H2O
?
-
ADAMTS5 is the most active aggrecanase compared to ADAMTS4 and is responsible for the generation of an oncostatin M-specific degradation pattern in the CS-2 region. ADAMTS5 has the ability to cleave at the oncostatin M-specific site adjacent to the aggrecan G3 region (Glu373-Ala374 bond). Truncation of the C-terminal TS domain or Sp domain does not affect the ability of the enzyme to cleave at this site
-
-
?
aggrecan + H2O
?
at Glu373/Ala374
-
-
?
aggrecan + H2O
?
-
-
-
-
?
aggrecan + H2O
?
-
cleavage at Glu373-Ala374 bond
-
-
?
aggrecan + H2O
?
40 microg
-
-
?
aggrecan + H2O
?
cleavage at Glu373-Ala374
-
-
?
aggrecan-interglobular domain + H2O
?
-
an aggrecan peptide with the N-terminal sequence ARGSVIL is released and quantified
-
-
?
aggrecan-interglobular domain + H2O
?
-
cleavage site Glu373-Ala374 in aggrecaninterglobular domain
-
-
?
brevican + H2O
?
-
-
-
-
?
brevican + H2O
?
-
assay at 37°C, 3 h, 25 nM recombinant ADAMTS
-
-
?
proteins + H2O
peptides
-
-
-
?
proteins + H2O
peptides
-
-
?
proteins + H2O
peptides
-
-
?
proteins + H2O
peptides
-
-
-
?
proteins + H2O
peptides
-
-
-
?
proteins + H2O
peptides
-
-
-
?
proteins + H2O
peptides
-
-
?
proteins + H2O
peptides
-
-
?
proteins + H2O
peptides
strict specificity for cleavage between glutamic acid and uncharged aliphatic amino acids in the core proteins of large aggregating proteoglycans
-
?
proteins + H2O
peptides
-
-
?
versican + H2O
?
-
-
-
?
versican + H2O
?
expression of Adamts5 during neuromuscular development and in smooth muscle cells coincides with the broadly distributed proteoglycan versican, an ADAMTS5 substrate
-
-
?
versican + H2O
?
-
cleaves versican at Glu441-Ala442 within the glycosaminoglycan beta region of versican V1
-
-
?
additional information
?
-
interaction with sulfated glucosaminglycan may be very important for the localization and activity of the enzyme
-
?
additional information
?
-
-
interaction with sulfated glucosaminglycan may be very important for the localization and activity of the enzyme
-
?
additional information
?
-
-
interaction with sulfated glucosaminglycan may be very important for the localization and activity of the enzymew
-
?
additional information
?
-
-
deglycosylated aggrecan is a poor substrate
-
-
?
additional information
?
-
recombinant protein substrate based on the IGD (interglobular domain) of aggrecan, gst-IGD-flag
-
-
?
additional information
?
-
-
recombinant protein substrate based on the IGD (interglobular domain) of aggrecan, gst-IGD-flag
-
-
?
additional information
?
-
-
ADAMTS-5 shows proteolytic activity by second TS domain and little by catalytic domain alone and exhibits 1000fold greater strength of proteolytic activities as compared to ADAMTS-4
-
-
?