Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

3.4.24.87: ADAMTS13 endopeptidase

This is an abbreviated version!
For detailed information about ADAMTS13 endopeptidase, go to the full flat file.

Word Map on EC 3.4.24.87

Reaction

The enzyme cleaves the von Willebrand factor at bond Tyr842-/-Met843 within the A2 domain =

Synonyms

a disintegrin and metalloprotease with thrombospondin motifs 13, a disintegrin and metalloprotease with thrombospondin type 1 repeats 13, a disintegrin and metalloprotease with thrombospondin-13, a disintegrin and metalloproteinase with a thrombonspondin type 1 motif member 13, a disintegrin and metalloproteinase with a thrombospondin motif repeats 13, a disintegrin and metalloproteinase with a thrombospondin type 1 motif, member 13, a disintegrin-like and metalloprotease with thrombospondin type I repeats – 13, a disintegrin-like and metalloprotease with thrombospondin type-1 motifs 13, a disintegrin-like and metalloproteinase domain with thrombospondin type I motifs 13, a disintegrin-like and metalloproteinase with thrombospondin type-1 motifs 13, a disintegrin-like domain and metalloprotease with thrombospondin type I motif, a thrombospondin type 1 motif, member 13, ADAMTS 13, ADAMTS VWF cleaving metalloprotease, ADAMTS-13, ADAMTS13, ADAMTS13 metalloprotease, M12.241, metalloprotease ADAMTS-13, More, plasma metalloprotease ADAMTS13, plasma von Willebrand factor cleaving activity, Upshaw factor, van Willebrand factor processing activity, von Willebrand cleavage protease, von Willebrand cleavaging protease, von Willebrand factor cleaving protease, von Willebrand factor specific cleaving protease, von Willebrand factor-cleaving metalloprotease, von Willebrand factor-cleaving protease, von Willebrand factor-cleaving proteinase, von-Willebrand factor cleaving protease, von-Willebrand factor degrading protease, von-Willebrand-factor-cleaving protease, VWF cleaving metalloprotease, VWF cleaving protease, vWF protease, VWF-cleaving metalloprotease, vWF-cleaving protease, VWF-CP, vWF-degrading protease, VWFCP, xWF-CP

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.24 Metalloendopeptidases
                3.4.24.87 ADAMTS13 endopeptidase

Substrates Products

Substrates Products on EC 3.4.24.87 - ADAMTS13 endopeptidase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
Collagen + H2O
?
show the reaction diagram
-
-
-
-
?
DREQAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQRA + H2O
?
show the reaction diagram
-
i.e. VWF74 peptide, a pseudo-wild-type peptide von Willebrand factor 74, VWF74, encompassing the von Willebrand factor, VWF, A2 domain sequence 1596-1669
-
-
?
fluorescence resonance energy transfer substrate-von Willebrand factor 73 + H2O
?
show the reaction diagram
-
-
-
-
?
fluorescent resonance energy transfer-von Willebrand factor 73 + H2O
?
show the reaction diagram
-
-
-
-
?
FRET-VWF115 peptide + H2O
?
show the reaction diagram
-
von Willebrand factor-derived peptide substrate comprising residues 1554-1668
-
-
?
FRET-VWF73 + H2O
?
show the reaction diagram
-
fluorogenic von Willebrand factor-derived peptide substrate. The distal C-terminal domains of ADAMTS13 are not necessary for the cleavage of the VWF73-based peptide substrate
-
-
?
FRETS-rVWF71 + H2O
?
show the reaction diagram
substrate based on von Willebrand factor residues Gln1599-Arg1668, with an N-terminal Gly and with mutations N1610C and K1617R. The N-terminus is modified with IRDye QC-1 Nhydroxysuccinimide ester, and Cys1610 is modified with DyLight 633 maleimide
-
-
?
FRETS-von Willebrand factor 73 + H2O
?
show the reaction diagram
FRETS-vWF73 + H2O
?
show the reaction diagram
-
a fluorogenic von Willebrand factor-derived peptide substrate
-
-
?
FRETS-VWF73 peptide + H2O
?
show the reaction diagram
-
fluorogenic von Willebrand factor-derived peptide substrate
-
-
?
FRETSVWF73 + H2O
?
show the reaction diagram
-
a von Willebrand factor-derived fluorescein-labeled peptide substrate
-
-
?
FRETSVWF73 peptide + H2O
?
show the reaction diagram
-
a von Willebrand factor-derived fluorescein-labeled peptide substrate
-
-
?
GST-von Willebrand factor 73 + H2O
?
show the reaction diagram
-
contains residues Asp1596-Arg1668 from von Willebrand factor domain A2
-
-
?
GST-VWF73 + H2O
?
show the reaction diagram
HRPH-A2-B
?
show the reaction diagram
-
HRPH-A2-B is a derivative of von Willebrand factor 73, consisting of a HRP conjugate of a biotinylated von Willebrand factor 78 sequence
cleavage of Tyr842-Met843 within the A2 domain, i.e. Tyr1605-Met1606 in von Willebrand factor UniProt Id P04275
-
?
large von Willebrand factor multimer + H2O
?
show the reaction diagram
-
-
-
-
?
proteins + H2O
peptides
show the reaction diagram
recombinant human VWF73 peptide + H2O
?
show the reaction diagram
-
-
-
?
ultra-large von Willebrand factor + H2O
?
show the reaction diagram
-
-
-
-
?
ultra-large von Willebrand factor multimer + H2O
?
show the reaction diagram
-
-
-
-
?
von Willebrand factor + H2O
2 peptides
show the reaction diagram
von Willebrand factor + H2O
2 peptides of 140 kD and 65 kD
show the reaction diagram
-
cleavage of peptide bond Tyr842-Met843
-
?
von Willebrand factor + H2O
2 peptides of 140 kDa and 176 kDa
show the reaction diagram
von Willebrand factor + H2O
2 peptides of 176 kD and 140 kD
show the reaction diagram
von Willebrand factor + H2O
?
show the reaction diagram
von Willebrand factor + H2O
von Willebrand factor 140-kD fragment + von Willebrand factor 176-kD fragment
show the reaction diagram
von Willebrand factor + H2O
von Willebrand factor fragments
show the reaction diagram
von Willebrand factor 115 (1554-1668) + H2O
?
show the reaction diagram
-
A2 domain fragment
-
-
?
von Willebrand factor 115 + H2O
10000 Da fragment of von Willebrand factor 115 + 7000 Da fragment of von Willebrand factor 115
show the reaction diagram
-
von Willebrand factor is cleaved at the Tyr1605-Met1606 bond in the von Willebrand factor A2 domain
-
-
?
von Willebrand factor 115-A3 (1554-1874) + H2O
?
show the reaction diagram
-
A2 domain fragment
-
-
?
von Willebrand factor 73 + H2O
7722 Da peptide + ?
show the reaction diagram
-
-
-
-
?
von Willebrand factor 73 + H2O
?
show the reaction diagram
-
minimal substrate cleavable by ADAMTS-13
-
-
?
von Willebrand factor 76 (1593-1668) + H2O
?
show the reaction diagram
-
A2 domain fragment
-
-
?
VWF115 + H2O
10 kDa VWF115 fragment + 7 kDa VWF115 fragment
show the reaction diagram
-
VWFA2 domain fragment, spanning von Willebrand factor residues 1554-1668, generation of 2 cleavage products of 10 kDa and 7 kDa
-
-
?
VWF115 + H2O
?
show the reaction diagram
VWF115 D1614A mutant + H2O
10 kDa VWF115 fragment + 7 kDa VWF115 fragment
show the reaction diagram
-
Asp1614 VWFA2 domain fragment, spanning von Willebrand factor residues 1554-1668, generation of 2 cleavage products of 10 kDa and 7 kDa
-
-
?
VWF73 peptide + H2O
?
show the reaction diagram
-
von Willebrand factor-derived peptide substrate
-
-
?
VWF73 region of von Willebrand factor + H2O
?
show the reaction diagram
-
with this minimal substrate urea is not required for cleavage, minimal substrate for ADAMTS-13
-
?
VWFA2 peptide + H2O
?
show the reaction diagram
substrate based on a 78-amino acid sequence corresponding to the sequence Leu1591-Arg1668 of the von Willebrand factor A2 domain
-
-
?
VWFA2 peptide + H2O
VWFA2 peptide fragments
show the reaction diagram
-
A2 domain fragment of von Willebrand factor, cleavage of oxidized or nonoxidized VWFA2 peptide by ADAMTS13, cleavage of the Tyr1605-Met(O)1606 peptide bond by ADAMTS13, overview
-
-
?
additional information
?
-