3.4.23.20: Penicillopepsin

This is an abbreviated version, for detailed information about Penicillopepsin, go to the full flat file.

Reaction

Hydrolysis of proteins with broad specificity similar to that of pepsin A, preferring hydrophobic residues at P1 and P1', but also cleaving Gly20-/-Glu in the B chain of insulin. Clots milk, and activates trypsinogen =

Synonyms

Acid protease A, EC 3.4.23.6, EC 3.4.23.7, mold kinase, More, pencillopepsin-JT1, pencillopepsin-JT2, Penicillium citrinum acid proteinase, Penicillium cyclopium acid proteinase, Penicillium expansum acid proteinase, Penicillium janthinellum acid proteinase, Penicillium janthinellum aspartic proteinase, penicillium kinase, Penicillium roqueforti acid proteinase, penicillopepsin-JT1, penicillopepsin-JT2, penicillopepsin-JT3, Peptidase A, Proteinase, Penicillium aspartic, Proteinase, Penicillium caseicolum aspartic, Proteinase, Penicillium citrinum aspartic, Proteinase, Penicillium cyclopium acid, Proteinase, Penicillium duponti aspartic, Proteinase, Penicillium expansum aspartic, Proteinase, Penicillium janthinellum acid, Proteinase, Penicillium roqueforti aspartic

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.23 Aspartic endopeptidases
                3.4.23.20 Penicillopepsin

Substrates Products

Substrates Products on EC 3.4.23.20 - Penicillopepsin

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
(4-Nitro)Phe-Nle-Ala-Leu methyl ester + H2O
Nle-Ala-Leu methyl ester + (4-nitro)Phe
show the reaction diagram
-
-
-
-
Ac-(Ala)m-Lys-(NO2)Phe-(Ala)n amide + H2O
?
show the reaction diagram
-
-
-
-
-
Ac-(Ala)n-Lys-Nph-(Ala)m-amide + H2O
Ac-(Ala)n-Lys + Nph-(Ala)m-amide
show the reaction diagram
-
-
-
?
Ac-Ala-Ala-Ala-Lys-(NO2)Phe-Ala-Ala-amide + H2O
?
show the reaction diagram
Ac-Ala-Ala-Lys-(4-nitro)Phe-Ala-Ala amide + H2O
?
show the reaction diagram
-
-
-
-
-
Ac-Ala-Ala-Lys-(NO2)Phe-Ala-Ala-amide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-Ala-Lys-(NO2)Phe-Ala-amide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-Ala-Lys-(NO2)Phe-amide + H2O
?
show the reaction diagram
Ac-Ala-Ala-Lys-(p-NO2)Phe-Ala-Ala-NH2 + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-Lys-(NO2)Phe-Ala-Ala-amide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-Lys-(NO2)Phe-Ala-amide + H2O
?
show the reaction diagram
Ac-Ala-Lys-(NO2)Phe-amide + H2O
?
show the reaction diagram
Ac-Lys 4-nitrophenyl amide + H2O
?
show the reaction diagram
-
-
-
-
-
Ac-Lys-(NO2)Phe- Ala-amide + H2O
?
show the reaction diagram
Ac-Lys-(NO2)Phe-Ala-Ala-amide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Lys-(NO2)Phe-amide + H2O
?
show the reaction diagram
Ac-Xaa-Lys-(NO2)Phe-Ala-Ala amide + H2O
?
show the reaction diagram
-
-
-
-
-
B-chain of S-sulfo-insulin + H2O
?
show the reaction diagram
-
-
-
-
-
Bovine serum albumin + H2O
?
show the reaction diagram
-
cleaves 15% of the peptide bonds
-
-
-
Egg albumin + H2O
?
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLCGSHLVEALYLVCG + ERGFFYTPKA
show the reaction diagram
i.e. insulin B chain, cleavage site specificity
-
-
?
H-Leu-Ser-(4-nitro)Phe-Nle-Ala-Leu methyl ester + H2O
Nle-Ala-Leu methyl ester + Leu-Ser-(4-nitro)Phe
show the reaction diagram
-
-
-
-
Hemoglobin + H2O
?
show the reaction diagram
Leu-Ser-(4-nitro)Phe-Nle-Ala-Leu methyl ester + H2O
?
show the reaction diagram
-
-
-
-
-
Milk casein + H2O
?
show the reaction diagram
Pro-Thr-Glu-Phe-(4-nitro)Phe-Arg-Leu + H2O
Pro-Thr-Glu-Phe + (4-nitro)Phe-Arg-Leu
show the reaction diagram
-
-
-
-
trypsin inhibitor + H2O
trypsin inhibitor fragments
show the reaction diagram
-
substrate from Cucurbita maxima, specific cleavage of Leu7-Met8 bond at pH 3.3
-
-
?
Trypsinogen + H2O
?
show the reaction diagram
trypsinogen + H2O
trypsin + propeptide Val(Asn)4-Lys-OH
show the reaction diagram
substrate from Bos taurus, rapid activation
-
-
?
trypsinogen + H2O
trypsin + Val(Asn)4-Lys
show the reaction diagram
additional information
?
-