Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

3.4.19.1: acylaminoacyl-peptidase

This is an abbreviated version!
For detailed information about acylaminoacyl-peptidase, go to the full flat file.

Word Map on EC 3.4.19.1

Reaction

cleavage of an N-acetyl or N-formyl amino acid from the N-terminus of a polypeptide =

Synonyms

AAP, AARE, AARE/OPH, AAREP, AcpH, acyl aminoacyl peptidase, acyl peptide hydrolase, Acyl-peptide hydrolase, acyl-peptide releasing enzyme, acylamino acid-releasing enzyme, acylamino acid-releasing enzyme/oxidized protein hydrolase, acylamino-acid-releasing enzyme, acylaminoacyl peptidase, Acylaminoacyl-peptidase, acylpeptide hydrolase, acylpeptide hydrolase/esterase, alpha-N-acylpeptide hydrolase, ApAAP, apAPH, APEH, APEH-1, apeH-2, APEH-3, APEH-3Ss, APEHs, APE_1547.1, APH, APHdr, AtAARE, BmAPH, cAARE, DNF15S2 protein, N-acylaminoacyl-peptide hydrolase, N-acylpeptide hydrolase, N-formylmethionine (fMet) aminopeptidase, OP85, PhAAP, pi-APH, PM hydrolase, PMH, SpAAP, sso2141, SSO2693, ST0779, yuxL

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.19 Omega peptidases
                3.4.19.1 acylaminoacyl-peptidase

Substrates Products

Substrates Products on EC 3.4.19.1 - acylaminoacyl-peptidase

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
2-aminobenzoyl-Ala-Leu-Phe-Gln-Gly-Pro-Phe(NO2)-Ala + H2O
2-aminobenzoyl-Ala-Leu-Phe + Gln-Gly-Pro-Phe(NO2)-Ala
show the reaction diagram
2-aminobenzoyl-EALFQGPF(NO2)A + H2O
?
show the reaction diagram
very good substrate
-
-
?
2-aminobenzoyl-EFSPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-GFEPF(NO2)RA + H2O
?
show the reaction diagram
good substrate, displays greater kinetic specificity than acetyl-Phe-2-naphthylamide
-
-
?
2-aminobenzoyl-KARVLF(NO2)EA-Nle + H2O
?
show the reaction diagram
poor substrate
-
-
?
2-aminobenzoyl-RPIITTAGPSF(NO2)A + H2O
?
show the reaction diagram
-
-
-
?
2-aminobenzoyl-SAVLQSGF(NO2)A + H2O
?
show the reaction diagram
good substrate
-
-
?
2-naphthyl butyrate + H2O
2-naphthol + butanoate
show the reaction diagram
-
-
-
-
?
4-nitrophenyl acetate + H2O
4-nitrophenol + acetate
show the reaction diagram
-
-
-
-
?
4-nitrophenyl caprylate + H2O
4-nitrophenol + caprylate
show the reaction diagram
Abz-EFSPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
Abz-GFEPF(NO2)RA + H2O
?
show the reaction diagram
-
-
-
?
Abz-KARVLF(NO2)EANle + H2O
?
show the reaction diagram
-
-
-
?
Abz-SAVLQSGF(NO2)A + H2O
?
show the reaction diagram
-
-
-
?
Ac-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
Ac-Ala-7-amido-4-methylcoumarin + H2O
N-acetyl-L-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
Ac-Ala-Ala + H2O
Ac-Ala + Ala
show the reaction diagram
Ac-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala
show the reaction diagram
Ac-Ala-Ala-Ala-Ala + H2O
Ac-Ala + Ala-Ala-Ala
show the reaction diagram
Ac-Leu-4-nitroanilide + H2O
Ac-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
?
Ac-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
?
Ac-Leu-p-nitroanilide + H2O
Ac-Leu + p-nitroaniline
show the reaction diagram
Ac-Phe-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
?
Ac-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
Ac-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
show the reaction diagram
-
-
-
?
acetyl-Ala-4-nitroanilide + H2O
acetyl-Ala + 4-nitroaniline
show the reaction diagram
acetyl-Ala-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
very slow hydrolysis
-
-
?
acetyl-Ala-7-amido-4-methylcoumarin + H2O
acetyl-Ala + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
-
?
acetyl-Ala-Ala + H2O
acetyl-Ala + Ala
show the reaction diagram
acetyl-Ala-Ala methyl ester + H2O
?
show the reaction diagram
-
-
-
-
?
Acetyl-Ala-Ala-Ala + H2O
Acetyl-Ala + Ala-Ala
show the reaction diagram
acetyl-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala
show the reaction diagram
acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
acetyl-Ala + Ala-Ala-Ala-Ala-Ala
show the reaction diagram
AB009494
-
-
-
?
acetyl-Ala-Ala-Phe-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
acetyl-Ala-Gly-D-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
acetyl-Ala-Met + H2O
acetyl-Ala + Met
show the reaction diagram
-
native enzyme shows 70.4% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Gly-Gly + H2O
acetyl-Gly + Gly
show the reaction diagram
acetyl-Gly-Leu + H2O
acetyl-Gly + Leu
show the reaction diagram
-
native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Leu-4-nitroanilide + H2O
acetyl-Leu + 4-nitroaniline
show the reaction diagram
acetyl-Met-7-amido-4-methylcoumarin + H2O
acetyl-Met + 7-amino-4-methylcoumarin
show the reaction diagram
-
-
-
?
acetyl-Met-Ala + H2O
acetyl-Met + Ala
show the reaction diagram
acetyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
acetyl-Met + Ala-Ala-Ala-Ala-Ala
show the reaction diagram
AB009494
-
-
-
?
acetyl-Met-Asn + H2O
acetyl-Met + Asn
show the reaction diagram
-
native enzyme shows 34.1% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Met-Glu + H2O
acetyl-Met + Glu
show the reaction diagram
acetyl-Met-Phe + H2O
acetyl-Met + Phe
show the reaction diagram
native enzyme shows 5% of the activity compared to acetyl-Ala-Ala as substrate
-
?
acetyl-Phe-2-naphthylamide + H2O
?
show the reaction diagram
classical substrate of AAP
-
-
?
acetyl-Phe-2-naphthylamide + H2O
acetyl-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
acetyl-Phe-4-nitroanilide + H2O
acetyl-Phe + 4-nitroaniline
show the reaction diagram
specificity rate constant is lower by one order of magnitude for acetyl-Leu-4-nitroanilide than for acetyl-Phe-4-nitroanilide
-
-
?
acetyl-Tyr-4-nitroanilide + H2O
acetyl-Tyr + 4-nitroaniline
show the reaction diagram
AB009494
-
-
-
?
Ala-Ala + H2O
Ala + Ala
show the reaction diagram
Ala-Ala-Ala + H2O
Ala + Ala-Ala
show the reaction diagram
Ala-Ala-Ala + H2O
Ala-Ala + Ala
show the reaction diagram
-
-
-
?
Ala-Ala-Ala-Ala + H2O
Ala + Ala-Ala-Ala
show the reaction diagram
-
-
-
?
Ala-Ala-Ala-Ala + H2O
Ala-Ala + Ala-Ala
show the reaction diagram
-
-
-
?
Ala-beta-naphthylamide + H2O
Ala + 2-naphthylamine
show the reaction diagram
Ala-p-nitroanilide + H2O
Ala + p-nitroaniline
show the reaction diagram
alpha-melanocyte stimulating hormone + H2O
?
show the reaction diagram
-
-
-
-
?
amyloid-beta peptide + H2O
?
show the reaction diagram
-
-
-
-
?
Asp-Ala-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
Asp-Pro-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
butyryl thiocholine + H2O
?
show the reaction diagram
-
-
-
-
?
butyryl-Ala-Ala-Ala + H2O
butyryl-Ala + Ala-Ala
show the reaction diagram
formyl-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala
show the reaction diagram
formyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
formyl-Ala + Ala-Ala-Ala-Ala-Ala
show the reaction diagram
AB009494
-
-
-
?
formyl-Gly-Val + H2O
formyl-Gly + Val
show the reaction diagram
-
native enzyme shows 30.3% of the activity compared to acetyl-Ala-Ala as substrate
-
?
formyl-Met-Ala + H2O
formyl-Met + Ala
show the reaction diagram
AB009494
-
-
-
?
formyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
formyl-Met + Ala-Ala-Ala-Ala-Ala
show the reaction diagram
AB009494
-
-
-
?
formyl-Met-Ala-Ser + H2O
formyl-Met + Ala-Ser
show the reaction diagram
AB009494
-
-
-
?
formyl-Met-Leu-Gly + H2O
formyl-Met + Leu-Gly
show the reaction diagram
AB009494
-
-
-
?
formylalanine-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylalanine-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine p-nitroanilide + H2O
formylmethionine + p-nitroaniline
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala + H2O
formylmethionine + Ala
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Ala-Ser + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-beta-naphthylamide + H2O
formylmethionine + beta-naphthylamine
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu + H2O
formylmethionine + Leu
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Phe + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Leu-Tyr + H2O
?
show the reaction diagram
-
-
-
-
?
formylmethionine-Phe + H2O
formylmethionine + Phe
show the reaction diagram
-
-
-
-
?
formylmethionine-Trp + H2O
formylmethionine + Trp
show the reaction diagram
-
-
-
-
?
formylmethionine-Val + H2O
formylmethionine + Val
show the reaction diagram
-
-
-
-
?
glutaryl-GGF-7-amido-4-methylcoumarin + H2O
?
show the reaction diagram
has a rate constant comparable to that of acetyl-Phe-2-naphthylamide
-
-
?
Gly-Ala-Ala + H2O
Gly-Ala + Ala
show the reaction diagram
-
-
-
?
Gly-Phe-2-naphthylamide + H2O
?
show the reaction diagram
-
-
-
?
Gly-Phe-2-naphthylamide + H2O
Gly-Phe + 2-naphthylamine
show the reaction diagram
-
-
-
?
glycated ribulose-1,5-diphosphate carboxylase/oxygenase protein + H2O
?
show the reaction diagram
-
no degradation of the native protein
-
?
isoAsp-Ala-p-nitroanilide + H2O
?
show the reaction diagram
-
-
-
-
?
isoD/DAEFRHDSGYEVHHQKLVFFAEDVGSNKGA-NH2 + H2O
?
show the reaction diagram
-
-
-
-
?
Leu-beta-naphthylamide + H2O
Leu + 2-naphthylamine
show the reaction diagram
N-acetyl-Ala ethyl ester + H2O
N-acetyl-Ala + ethanol
show the reaction diagram
-
-
-
?
N-acetyl-Ala p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
show the reaction diagram
N-acetyl-Ala-Ala + H2O
N-acetyl-Ala + Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala + H2O
N-acetyl-Ala + Ala-Ala-Ala
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
N-acetyl-Ala-Ala-Ala-Ala-Glu-Glu-Glu-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Arg-Gly + H2O
N-acetyl-Ala + Ala-Arg-Gly
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gln-Nepsilon-acetyl-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gln-Nepsilon-succinyl-Lys + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-His-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Phe-Gly + H2O
N-acetyl-Ala + Ala-Phe-Gly
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Pro + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ala-Pro-Ala + H2O
N-acetyl-Ala + Ala-Pro-Ala
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Asp + H2O
N-acetyl-Ala + Asp
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-beta-naphthylamide + H2O
N-acetyl-Ala + beta-naphthylamine
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Gly + H2O
N-acetyl-Ala + Gly
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Gly-Ala-D-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-His-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Leu + H2O
N-acetyl-Ala + Leu
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Lys + H2O
N-acetyl-Ala + Lys
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Met + H2O
N-acetyl-Ala + Met
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-p-nitroanilide + H2O
N-acetyl-Ala + p-nitroaniline
show the reaction diagram
N-acetyl-Ala-Phe + H2O
N-acetyl-Ala + Phe
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Ser + H2O
N-acetyl-Ala + Ser
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Thr + H2O
N-acetyl-Ala + Thr
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Trp + H2O
N-acetyl-Ala + Trp
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Tyr + H2O
N-acetyl-Ala + Tyr
show the reaction diagram
-
-
-
-
?
N-acetyl-Ala-Tyr-Ile + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-alanyl-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Glu p-nitroanilide + H2O
N-acetyl-Glu + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Gly-Ala + H2O
N-acetyl-Gly + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acetyl-Gly-p-nitroanilide + H2O
N-acetyl-Gly + p-nitroaniline
show the reaction diagram
N-acetyl-L-Ala-4-nitroanilide + H2O
N-acetyl-L-Ala + 4-nitroaniline
show the reaction diagram
N-acetyl-L-alanine 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-L-alanyl 4-nitroanilide + H2O
N-acetyl-L-alanine + 4-nitroaniline
show the reaction diagram
N-acetyl-L-alanyl-p-nitroanilide + H2O
N-acetyl-L-alanine + p-nitroaniline
show the reaction diagram
N-acetyl-L-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
N-acetyl-L-leucyl 4-nitroanilide + H2O
N-acetyl-L-leucine + 4-nitroaniline
show the reaction diagram
N-acetyl-L-Met-alpha-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-Ala-NH2
show the reaction diagram
-
-
-
-
?
N-acetyl-L-Met-epsilon-L-Lys-Ala-NH2 + H2O
N-acetyl-L-Met + L-Lys-L-Ala-NH2
show the reaction diagram
-
-
-
?
N-acetyl-L-Phe-4-nitroanilide + H2O
N-acetyl-L-Phe + 4-nitroaniline
show the reaction diagram
-
-
-
?
N-acetyl-L-phenylalanyl 4-nitroanilide + H2O
N-acetyl-L-phenylalanine + 4-nitroaniline
show the reaction diagram
N-acetyl-Leu p-nitroanilide + H2O
N-acetyl-Leu + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-L-Leu + 4-nitroaniline
show the reaction diagram
N-acetyl-Leu-4-nitroanilide + H2O
N-acetyl-Leu + 4-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-Ala + H2O
N-acetyl-Leu + Ala
show the reaction diagram
-
-
-
-
?
N-acetyl-Leu-p-nitroanilide + H2O
N-acetyl-Leu + p-nitroaniline
show the reaction diagram
esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
-
-
?
N-acetyl-Met-Ala + H2O
N-acetyl-Met + Ala
show the reaction diagram
N-acetyl-Met-Ala-Ala-Ala-Ala-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Asp-Arg-Val-Leu-Ser-Arg-Tyr + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Asp-Glu-Thr-Gly-Asp-Thr-Ala-Leu-Val-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-epsilon-Lys + H2O
N-acetyl-Met + Lys
show the reaction diagram
-
-
-
?
N-acetyl-Met-Leu + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Leu-Gly + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Leu-Phe + H2O
?
show the reaction diagram
-
-
-
-
?
N-acetyl-Met-Lys + H2O
N-acetyl-Met + Lys
show the reaction diagram
-
-
-
?
N-acetyl-Met-p-nitroanilide + H2O
N-acetyl-Met + p-nitroaniline
show the reaction diagram
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-L-Phe + 2-naphthylamine
show the reaction diagram
kinetic assay
-
-
?
N-acetyl-Phe-2-naphthylamide + H2O
N-acetyl-Phe + 2-naphthylamine
show the reaction diagram
N-acetyl-Phe-Ala + H2O
N-acetyl-Phe + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acetyl-Ser-Ala + H2O
N-acetyl-Ser + Ala
show the reaction diagram
-
-
-
-
?
N-acetyl-Tyr p-nitroanilide + H2O
N-acetyl-Tyr + p-nitroaniline
show the reaction diagram
-
-
-
-
?
N-acetyl-Tyr-Ala + H2O
N-acetyl-Tyr + Ala
show the reaction diagram
-
weak activity
-
-
?
N-acylpeptide + H2O
?
show the reaction diagram
-
acylpeptide hydrolase catalyzes the hydrolysis of short peptides of the type Nalpha-acyl to form an acyl amino acid and a peptide with a free N-terminus
-
-
?
naphthyl butyrate + H2O
naphthol + butyrate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl acetate + H2O
4-nitrophenol + acetate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl butyrate + H2O
?
show the reaction diagram
-
-
-
-
?
p-nitrophenyl caprylate + H2O
nitrophenol + caprylate
show the reaction diagram
esterase activity of wild-type enzyme with p-nitrophenyl caprylate as substrate is 7times higher than peptidase activity with N-acetyl-Leu-p-nitroanilide as substrate, 150fold higher for mutant enzyme R526V, peptidase activity for mutant R526E is abolished
-
-
?
p-nitrophenyl hexanoate + H2O
p-nitrophenol + hexanoate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl propionate + H2O
p-nitrophenol + propionate
show the reaction diagram
-
-
-
-
?
p-nitrophenyl valerate + H2O
p-nitrophenol + pentanoate
show the reaction diagram
-
-
-
-
?
Phe-beta-naphthylamide + H2O
Phe + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
Phe-p-nitroanilide + H2O
Phe + p-nitroaniline
show the reaction diagram
-
prefered substrate for PMH
-
-
?
Pro-beta-naphthylamide + H2O
Pro + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
puromycin + H2O
?
show the reaction diagram
-
-
-
-
?
succinyl-AAA-4-nitroanilide + H2O
succinyl-AAA + 4-nitroaniline
show the reaction diagram
-
-
-
?
succinyl-AAPF-2-naphthylamide + H2O
?
show the reaction diagram
hydrolysed at a significantly slower rate than acetyl-Phe-2-naphthylamide
-
-
?
succinyl-GGF-4-nitroanilide + H2O
succinyl-GGF + 4-nitroaniline
show the reaction diagram
-
-
-
?
Tyr-beta-naphthylamide + H2O
Tyr + 2-naphthylamine
show the reaction diagram
-
-
-
-
?
Tyr-Leu + H2O
Tyr + Leu
show the reaction diagram
Tyr-Phe + H2O
Tyr + Phe
show the reaction diagram
Z-GGL-4-nitroanilide + H2O
Z-GGL + 4-nitroaniline
show the reaction diagram
-
-
-
?
additional information
?
-